BLASTX nr result
ID: Mentha26_contig00032992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032992 (589 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_022231026.1| aTPase AAA-2 domain protein [Firmicutes bact... 61 2e-07 >ref|WP_022231026.1| aTPase AAA-2 domain protein [Firmicutes bacterium CAG:41] gi|524453234|emb|CDB99268.1| aTPase AAA-2 domain protein [Firmicutes bacterium CAG:41] Length = 817 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/111 (28%), Positives = 59/111 (53%) Frame = -3 Query: 587 GVAEDSEGNVTSFENCVVVIISDLGNKEIISKLINRDFPKCKSRKGGVECSESDKTVKQE 408 G+ D++G F+N V+++ S+LG KEI+ + S+ G + E DK + + Sbjct: 643 GILTDAQGRKVDFKNTVIIMTSNLGAKEILGNV--------SSKLGFKKDEEKDKNISEH 694 Query: 407 AYGSSSTNEMGLRGLRFELLHRLDQILLFDPFSDDQLNRFAMLMMKELKEK 255 + E R + E L+R+D I++FD ++D + A LM+K L+++ Sbjct: 695 DSIKNKVMEEVKRAFKPEFLNRIDDIIVFDRLTEDNIKEIAKLMLKSLEKR 745