BLASTX nr result
ID: Mentha26_contig00032794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032794 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS54643.1| Wall-associated receptor kinase 1 [Triticum urartu] 56 5e-06 >gb|EMS54643.1| Wall-associated receptor kinase 1 [Triticum urartu] Length = 731 Score = 56.2 bits (134), Expect = 5e-06 Identities = 40/95 (42%), Positives = 51/95 (53%), Gaps = 18/95 (18%) Frame = +2 Query: 83 GLAYLQSQNPRATAAFIHGNVCSGNILLDASFDHAKLFYAAASSLIDRDRDRDASF---- 250 GLAY+ SQ A +HG+V NILLD +F AK+ S L+ RD++ AS Sbjct: 482 GLAYMHSQ---ANTRILHGDVKPANILLDDNFI-AKISDFGISRLLARDKEHTASIIGDI 537 Query: 251 --------------EKSDVYSFGVVLVELLSRRTA 313 EKSDVYSFGVV++EL+S R A Sbjct: 538 NYMDPVYLQEGLLTEKSDVYSFGVVILELISGRRA 572