BLASTX nr result
ID: Mentha26_contig00032753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032753 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25333.1| hypothetical protein MIMGU_mgv1a012984mg [Mimulus... 83 3e-14 ref|XP_006343686.1| PREDICTED: DCN1-like protein 4-like [Solanum... 74 2e-11 ref|XP_004242560.1| PREDICTED: DCN1-like protein 4-like [Solanum... 74 2e-11 ref|XP_007012003.1| Domain of Uncharacterized protein function (... 74 2e-11 ref|XP_007012001.1| Domain of Uncharacterized protein function i... 74 2e-11 ref|XP_002325151.2| hypothetical protein POPTR_0018s12020g [Popu... 73 4e-11 gb|EYU24619.1| hypothetical protein MIMGU_mgv1a013122mg [Mimulus... 72 6e-11 ref|XP_007023386.1| Domain of Uncharacterized protein function (... 71 1e-10 ref|XP_004287216.1| PREDICTED: DCN1-like protein 4-like [Fragari... 71 1e-10 gb|AFK41487.1| unknown [Lotus japonicus] 71 1e-10 ref|XP_007215963.1| hypothetical protein PRUPE_ppa011419mg [Prun... 70 2e-10 ref|XP_006473966.1| PREDICTED: DCN1-like protein 4-like isoform ... 70 3e-10 ref|XP_006453676.1| hypothetical protein CICLE_v10009421mg [Citr... 70 3e-10 ref|XP_006427582.1| hypothetical protein CICLE_v10026425mg [Citr... 70 3e-10 ref|XP_003632772.1| PREDICTED: DCN1-like protein 4 isoform 2 [Vi... 70 3e-10 ref|XP_002273365.1| PREDICTED: DCN1-like protein 4 isoform 1 [Vi... 70 3e-10 gb|EYU21716.1| hypothetical protein MIMGU_mgv1a013128mg [Mimulus... 69 5e-10 ref|XP_004303258.1| PREDICTED: DCN1-like protein 4-like [Fragari... 69 7e-10 ref|NP_001236969.1| uncharacterized protein LOC100499856 [Glycin... 69 7e-10 ref|XP_004515517.1| PREDICTED: DCN1-like protein 4-like isoform ... 69 9e-10 >gb|EYU25333.1| hypothetical protein MIMGU_mgv1a012984mg [Mimulus guttatus] Length = 234 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQADVGS 137 QWTNF RFCQEISFPDL NYDT EAWPL+LDNFV+W K+ A+V S Sbjct: 189 QWTNFLRFCQEISFPDLANYDTGEAWPLLLDNFVEWMKQNANVDS 233 >ref|XP_006343686.1| PREDICTED: DCN1-like protein 4-like [Solanum tuberosum] Length = 229 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW NF RFCQE+SFPDL NYD D+AWP+ILDNFV+W + + Sbjct: 188 QWMNFLRFCQEVSFPDLENYDLDQAWPVILDNFVEWMREK 227 >ref|XP_004242560.1| PREDICTED: DCN1-like protein 4-like [Solanum lycopersicum] Length = 229 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW NF RFCQE+SFPDL NYD D+AWP+ILDNFV+W + + Sbjct: 188 QWMNFLRFCQEVSFPDLENYDLDQAWPVILDNFVEWMREK 227 >ref|XP_007012003.1| Domain of Uncharacterized protein function (DUF298) isoform 3 [Theobroma cacao] gi|508782366|gb|EOY29622.1| Domain of Uncharacterized protein function (DUF298) isoform 3 [Theobroma cacao] Length = 155 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW NF RFCQEI+FPDL NYD +AWPLILDNFVDW + + Sbjct: 112 QWINFLRFCQEINFPDLENYDATQAWPLILDNFVDWMREK 151 >ref|XP_007012001.1| Domain of Uncharacterized protein function isoform 1 [Theobroma cacao] gi|508782364|gb|EOY29620.1| Domain of Uncharacterized protein function isoform 1 [Theobroma cacao] Length = 230 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW NF RFCQEI+FPDL NYD +AWPLILDNFVDW + + Sbjct: 187 QWINFLRFCQEINFPDLENYDATQAWPLILDNFVDWMREK 226 >ref|XP_002325151.2| hypothetical protein POPTR_0018s12020g [Populus trichocarpa] gi|550318560|gb|EEF03716.2| hypothetical protein POPTR_0018s12020g [Populus trichocarpa] Length = 230 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW F RFC+EISFPDL NYD D AWPLILDNFVDW K + Sbjct: 189 QWMGFLRFCKEISFPDLENYDADLAWPLILDNFVDWMKEK 228 >gb|EYU24619.1| hypothetical protein MIMGU_mgv1a013122mg [Mimulus guttatus] Length = 230 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW F+RFC EISFPDL+NYD D AWPLILDNFVDW + Sbjct: 189 QWMGFYRFCNEISFPDLSNYDPDLAWPLILDNFVDWLR 226 >ref|XP_007023386.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] gi|590616020|ref|XP_007023387.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] gi|508778752|gb|EOY26008.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] gi|508778753|gb|EOY26009.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] Length = 232 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDW 110 QW FFRFC EISFPDLNNY+ D AWPL+LDNFV+W Sbjct: 191 QWMGFFRFCNEISFPDLNNYNPDLAWPLVLDNFVEW 226 >ref|XP_004287216.1| PREDICTED: DCN1-like protein 4-like [Fragaria vesca subsp. vesca] Length = 230 Score = 71.2 bits (173), Expect = 1e-10 Identities = 26/38 (68%), Positives = 35/38 (92%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW +F+RFC+EISFPDL +YD+D+AWP+I+DNFV+W K Sbjct: 188 QWRHFYRFCKEISFPDLEDYDSDQAWPVIIDNFVEWMK 225 >gb|AFK41487.1| unknown [Lotus japonicus] Length = 231 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW FFRFC EISFP LN+YD D AWPLILDNFVDW + Sbjct: 190 QWMGFFRFCNEISFPSLNDYDPDLAWPLILDNFVDWLR 227 >ref|XP_007215963.1| hypothetical protein PRUPE_ppa011419mg [Prunus persica] gi|462412113|gb|EMJ17162.1| hypothetical protein PRUPE_ppa011419mg [Prunus persica] Length = 211 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW F+RFC+EISFPDL+NYD + AWPLILDNFV+W + + Sbjct: 168 QWMGFYRFCEEISFPDLSNYDPELAWPLILDNFVEWLREK 207 >ref|XP_006473966.1| PREDICTED: DCN1-like protein 4-like isoform X1 [Citrus sinensis] Length = 223 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW FRFC EISFPDL NYD +AWPLILDNFVDW + Sbjct: 182 QWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLR 219 >ref|XP_006453676.1| hypothetical protein CICLE_v10009421mg [Citrus clementina] gi|567923342|ref|XP_006453677.1| hypothetical protein CICLE_v10009421mg [Citrus clementina] gi|568840014|ref|XP_006473967.1| PREDICTED: DCN1-like protein 4-like isoform X2 [Citrus sinensis] gi|557556902|gb|ESR66916.1| hypothetical protein CICLE_v10009421mg [Citrus clementina] gi|557556903|gb|ESR66917.1| hypothetical protein CICLE_v10009421mg [Citrus clementina] Length = 222 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW FRFC EISFPDL NYD +AWPLILDNFVDW + Sbjct: 181 QWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLR 218 >ref|XP_006427582.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|567869923|ref|XP_006427583.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|567869925|ref|XP_006427584.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|568821517|ref|XP_006465206.1| PREDICTED: DCN1-like protein 4-like isoform X1 [Citrus sinensis] gi|568821519|ref|XP_006465207.1| PREDICTED: DCN1-like protein 4-like isoform X2 [Citrus sinensis] gi|568821521|ref|XP_006465208.1| PREDICTED: DCN1-like protein 4-like isoform X3 [Citrus sinensis] gi|557529572|gb|ESR40822.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|557529573|gb|ESR40823.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|557529574|gb|ESR40824.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] Length = 226 Score = 70.1 bits (170), Expect = 3e-10 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW F+RFC EISFPD NNYD + AWPL+LDNFV+W K Sbjct: 185 QWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMK 222 >ref|XP_003632772.1| PREDICTED: DCN1-like protein 4 isoform 2 [Vitis vinifera] Length = 212 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW FFRFC EISFPDL NYD + AWPLILDNFV+W + Sbjct: 171 QWMGFFRFCNEISFPDLRNYDPELAWPLILDNFVEWRR 208 >ref|XP_002273365.1| PREDICTED: DCN1-like protein 4 isoform 1 [Vitis vinifera] gi|297743605|emb|CBI36472.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW FFRFC EISFPDL NYD + AWPLILDNFV+W + Sbjct: 190 QWMGFFRFCNEISFPDLRNYDPELAWPLILDNFVEWRR 227 >gb|EYU21716.1| hypothetical protein MIMGU_mgv1a013128mg [Mimulus guttatus] Length = 230 Score = 69.3 bits (168), Expect = 5e-10 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTK 116 QW F+RFC EI+FP+L+NYD+D+AWPLI+D+FVDW + Sbjct: 189 QWMGFYRFCNEINFPELDNYDSDQAWPLIVDDFVDWIR 226 >ref|XP_004303258.1| PREDICTED: DCN1-like protein 4-like [Fragaria vesca subsp. vesca] Length = 206 Score = 68.9 bits (167), Expect = 7e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW F+RFC EIS+PDL+NYD + AWPLILDNFV+W + + Sbjct: 165 QWMGFYRFCDEISYPDLSNYDPELAWPLILDNFVEWVREK 204 >ref|NP_001236969.1| uncharacterized protein LOC100499856 [Glycine max] gi|571468919|ref|XP_006584505.1| PREDICTED: uncharacterized protein LOC100499856 isoform X1 [Glycine max] gi|571468921|ref|XP_006584506.1| PREDICTED: uncharacterized protein LOC100499856 isoform X2 [Glycine max] gi|255627169|gb|ACU13929.1| unknown [Glycine max] Length = 228 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW FFRFC EISFP LN+YD++ AWPLILDNFV+W + + Sbjct: 187 QWMGFFRFCNEISFPTLNDYDSELAWPLILDNFVEWLREK 226 >ref|XP_004515517.1| PREDICTED: DCN1-like protein 4-like isoform X1 [Cicer arietinum] gi|502174439|ref|XP_004515518.1| PREDICTED: DCN1-like protein 4-like isoform X2 [Cicer arietinum] Length = 231 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 3 QWTNFFRFCQEISFPDLNNYDTDEAWPLILDNFVDWTKRQ 122 QW FFRFC EISFP L+NYD + AWPLILDNFV+W + + Sbjct: 190 QWMGFFRFCNEISFPSLDNYDPELAWPLILDNFVEWLREK 229