BLASTX nr result
ID: Mentha26_contig00032726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032726 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23890.1| hypothetical protein MIMGU_mgv1a009498mg [Mimulus... 65 1e-08 ref|XP_004242025.1| PREDICTED: UDP-galactose transporter 1-like ... 64 3e-08 ref|XP_007222472.1| hypothetical protein PRUPE_ppa008225mg [Prun... 63 5e-08 gb|EYU22959.1| hypothetical protein MIMGU_mgv1a009793mg [Mimulus... 62 8e-08 ref|XP_006363895.1| PREDICTED: GDP-mannose transporter GONST5-li... 62 8e-08 ref|XP_004142623.1| PREDICTED: UDP-galactose transporter 1-like ... 59 7e-07 ref|XP_004290862.1| PREDICTED: UDP-galactose transporter 1-like ... 59 9e-07 ref|XP_002285850.1| PREDICTED: UDP-galactose transporter 1 isofo... 59 9e-07 ref|XP_004250314.1| PREDICTED: GDP-mannose transporter GONST5-li... 57 3e-06 ref|XP_002516337.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 gb|EXB44379.1| UDP-galactose transporter 1 [Morus notabilis] 57 3e-06 gb|AFK42237.1| unknown [Medicago truncatula] 56 5e-06 ref|XP_003589584.1| Solute carrier family 35 member E3 [Medicago... 56 5e-06 >gb|EYU23890.1| hypothetical protein MIMGU_mgv1a009498mg [Mimulus guttatus] Length = 340 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEESRLCQWSVIRS+LAI+QWWGFNVTVII Sbjct: 1 MEESRLCQWSVIRSVLAILQWWGFNVTVII 30 >ref|XP_004242025.1| PREDICTED: UDP-galactose transporter 1-like [Solanum lycopersicum] Length = 340 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEESRLCQW+VIRS+LAI+QWWGFNVTVII Sbjct: 1 MEESRLCQWTVIRSVLAILQWWGFNVTVII 30 >ref|XP_007222472.1| hypothetical protein PRUPE_ppa008225mg [Prunus persica] gi|462419408|gb|EMJ23671.1| hypothetical protein PRUPE_ppa008225mg [Prunus persica] Length = 340 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE+RLCQWSVIRS+LAI+QWWGFNVTVI+ Sbjct: 1 MEETRLCQWSVIRSLLAILQWWGFNVTVIV 30 >gb|EYU22959.1| hypothetical protein MIMGU_mgv1a009793mg [Mimulus guttatus] Length = 331 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 252 IMEESRLCQWSVIRSILAIVQWWGFNVTVII 344 +MEESRLCQWSVIRS+LAI QWW FNVTVII Sbjct: 1 MMEESRLCQWSVIRSVLAIFQWWAFNVTVII 31 >ref|XP_006363895.1| PREDICTED: GDP-mannose transporter GONST5-like [Solanum tuberosum] Length = 340 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE RLCQW+VIRS+LAI+QWWGFNVTVII Sbjct: 1 MEEGRLCQWTVIRSVLAILQWWGFNVTVII 30 >ref|XP_004142623.1| PREDICTED: UDP-galactose transporter 1-like [Cucumis sativus] gi|449500709|ref|XP_004161174.1| PREDICTED: UDP-galactose transporter 1-like [Cucumis sativus] Length = 343 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE+RLCQW+ IRS+ AI+QWWGFNVTVII Sbjct: 1 MEEARLCQWTTIRSLFAILQWWGFNVTVII 30 >ref|XP_004290862.1| PREDICTED: UDP-galactose transporter 1-like [Fragaria vesca subsp. vesca] Length = 344 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE+RLCQWSVIRS+LA++QWW FNVTV++ Sbjct: 1 MEETRLCQWSVIRSLLAVLQWWVFNVTVVV 30 >ref|XP_002285850.1| PREDICTED: UDP-galactose transporter 1 isoform 1 [Vitis vinifera] gi|225459546|ref|XP_002285851.1| PREDICTED: UDP-galactose transporter 1 isoform 2 [Vitis vinifera] gi|147794987|emb|CAN67423.1| hypothetical protein VITISV_006650 [Vitis vinifera] gi|302141824|emb|CBI19027.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEES LCQWS RS+LAI+QWWGFNVTVII Sbjct: 1 MEESLLCQWSAFRSLLAILQWWGFNVTVII 30 >ref|XP_004250314.1| PREDICTED: GDP-mannose transporter GONST5-like [Solanum lycopersicum] Length = 337 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE+ LCQWSV+RSI AI+QWWGFNV VII Sbjct: 1 MEENVLCQWSVVRSIFAILQWWGFNVAVII 30 >ref|XP_002516337.1| conserved hypothetical protein [Ricinus communis] gi|223544567|gb|EEF46084.1| conserved hypothetical protein [Ricinus communis] Length = 342 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEES LCQWSV RS+LAI+QWW FNVTVII Sbjct: 1 MEESVLCQWSVFRSLLAIIQWWVFNVTVII 30 >gb|EXB44379.1| UDP-galactose transporter 1 [Morus notabilis] Length = 340 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEES +CQWSVIRS+LAI+QWW FNV VI+ Sbjct: 1 MEESWICQWSVIRSLLAIIQWWSFNVAVIV 30 >gb|AFK42237.1| unknown [Medicago truncatula] Length = 342 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE +CQWSV+RS+LAI+QWW FNVTVII Sbjct: 1 MEEGLVCQWSVVRSLLAILQWWAFNVTVII 30 >ref|XP_003589584.1| Solute carrier family 35 member E3 [Medicago truncatula] gi|355478632|gb|AES59835.1| Solute carrier family 35 member E3 [Medicago truncatula] Length = 342 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 255 MEESRLCQWSVIRSILAIVQWWGFNVTVII 344 MEE +CQWSV+RS+LAI+QWW FNVTVII Sbjct: 1 MEEGLVCQWSVVRSLLAILQWWAFNVTVII 30