BLASTX nr result
ID: Mentha26_contig00032533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032533 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74193.1| hypothetical protein M569_00557, partial [Genlise... 58 2e-06 ref|XP_002533080.1| PAC, putative [Ricinus communis] gi|22352714... 57 2e-06 ref|XP_004172947.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 57 4e-06 ref|XP_004140086.1| PREDICTED: uncharacterized protein LOC101220... 57 4e-06 ref|XP_004307135.1| PREDICTED: protein PALE CRESS, chloroplastic... 56 5e-06 gb|EXB39335.1| hypothetical protein L484_025030 [Morus notabilis] 56 6e-06 >gb|EPS74193.1| hypothetical protein M569_00557, partial [Genlisea aurea] Length = 264 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 4 CKKLMIETFPREDPFSILVPAGFDLDKVNNP 96 C+K+M+ETFPREDPFS+LVPAGFD+DK P Sbjct: 159 CRKIMVETFPREDPFSLLVPAGFDIDKHEGP 189 >ref|XP_002533080.1| PAC, putative [Ricinus communis] gi|223527144|gb|EEF29319.1| PAC, putative [Ricinus communis] Length = 137 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 4 CKKLMIETFPREDPFSILVPAGFDLDKVNNP 96 CKK MI+TFPREDPFSILVPAGFD+DK P Sbjct: 34 CKKRMIDTFPREDPFSILVPAGFDIDKHQGP 64 >ref|XP_004172947.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230907 [Cucumis sativus] Length = 220 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 1 SCKKLMIETFPREDPFSILVPAGFDLDKVNNP 96 +C+K M++TFPREDPFSILVPAGFD+DK P Sbjct: 112 ACRKCMVDTFPREDPFSILVPAGFDIDKHQGP 143 >ref|XP_004140086.1| PREDICTED: uncharacterized protein LOC101220904 [Cucumis sativus] Length = 314 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 1 SCKKLMIETFPREDPFSILVPAGFDLDKVNNP 96 +C+K M++TFPREDPFSILVPAGFD+DK P Sbjct: 206 ACRKCMVDTFPREDPFSILVPAGFDIDKHQGP 237 >ref|XP_004307135.1| PREDICTED: protein PALE CRESS, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 311 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 4 CKKLMIETFPREDPFSILVPAGFDLDKVNNP 96 CKK MI+TFPREDPFSILVP GFDLDK P Sbjct: 208 CKKCMIDTFPREDPFSILVPDGFDLDKHEGP 238 >gb|EXB39335.1| hypothetical protein L484_025030 [Morus notabilis] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 4 CKKLMIETFPREDPFSILVPAGFDLDKVNNP 96 CKKLM++TFPREDPFSILVP GFD+D+ P Sbjct: 211 CKKLMVDTFPREDPFSILVPPGFDIDEHQGP 241