BLASTX nr result
ID: Mentha26_contig00032444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032444 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61302.1| hypothetical protein M569_13492 [Genlisea aurea] 59 9e-07 >gb|EPS61302.1| hypothetical protein M569_13492 [Genlisea aurea] Length = 536 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 7/72 (9%) Frame = -1 Query: 196 LSIRNFASPID-----AAADPEKSGNDENPVVKRLSDELQKNP--DVEPLPLGKRLDLSF 38 LS+R F+S D A + S +E + K +SDEL+KN + E LPL KRLDLSF Sbjct: 58 LSVRFFSSRTDEDDDGARSTARASEEEEGALAKLISDELRKNRQGEGEVLPLAKRLDLSF 117 Query: 37 SHVQITPAVLLA 2 SHV +TPA+LLA Sbjct: 118 SHVTVTPALLLA 129