BLASTX nr result
ID: Mentha26_contig00032298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032298 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28728.1| hypothetical protein MIMGU_mgv1a012660mg [Mimulus... 56 6e-06 >gb|EYU28728.1| hypothetical protein MIMGU_mgv1a012660mg [Mimulus guttatus] Length = 244 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 100 MSPSEYTAEVTSLSPKATEKDVYDFFAFCGSID 2 MSPS YT EVT+LSP TEKDV+DFF FCG+I+ Sbjct: 1 MSPSGYTVEVTNLSPNTTEKDVHDFFGFCGAIE 33