BLASTX nr result
ID: Mentha26_contig00032277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032277 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31194.1| hypothetical protein MIMGU_mgv1a006512mg [Mimulus... 91 2e-16 >gb|EYU31194.1| hypothetical protein MIMGU_mgv1a006512mg [Mimulus guttatus] Length = 441 Score = 90.5 bits (223), Expect = 2e-16 Identities = 50/79 (63%), Positives = 56/79 (70%), Gaps = 5/79 (6%) Frame = +3 Query: 87 MPTFTAIALDRLLEPGAAKSMVEARNSPDSKLGRRRSTSNS-----IDAPTSMMERGSGI 251 MPTFTA+ALDRL+EPG AKSMV RNS DSKL RR ST S I + S +ERG+ I Sbjct: 1 MPTFTALALDRLIEPGTAKSMVPPRNSTDSKLERRHSTPYSTEDVVIVSSGSKVERGASI 60 Query: 252 PPNPKTVRGVHVPSNTNLD 308 PP PK RGV VP NTNL+ Sbjct: 61 PPLPKIERGVSVPPNTNLE 79