BLASTX nr result
ID: Mentha26_contig00032141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032141 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK10711.1| ribosomal protein S2-like isoform 3 [Callorhinchu... 65 1e-08 dbj|BAE73006.1| hypothetical protein [Macaca fascicularis] 64 2e-08 ref|NP_001128241.1| actin, cytoplasmic 2 [Pan troglodytes] gi|14... 62 6e-08 tpg|DAA15244.1| TPA: hypothetical protein BOS_23187 [Bos taurus] 62 8e-08 gb|ACQ58312.1| Hemoglobin subunit alpha-2 [Anoplopoma fimbria] 62 8e-08 dbj|BAE89779.1| unnamed protein product [Macaca fascicularis] 62 8e-08 ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter... 61 2e-07 gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira o... 50 9e-07 >gb|AFK10711.1| ribosomal protein S2-like isoform 3 [Callorhinchus milii] Length = 325 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 269 MIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 MIKRD RGHSYC ARGEILGP+QDE +RKHLPRM Sbjct: 1 MIKRDGRGHSYCAARGEILGPAQDERERKHLPRM 34 >dbj|BAE73006.1| hypothetical protein [Macaca fascicularis] Length = 218 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 260 SEVMIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 +E MIKRD RGHSYC ARGEILGP+QD +RKHLPRM Sbjct: 164 TEAMIKRDGRGHSYCAARGEILGPAQDGPERKHLPRM 200 >ref|NP_001128241.1| actin, cytoplasmic 2 [Pan troglodytes] gi|146741496|dbj|BAF62404.1| actin, gamma 1 [Pan troglodytes verus] Length = 381 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 263 EVMIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 + MIKRD RGHSYC ARGEILGP+QD +RKHLPRM Sbjct: 113 KAMIKRDGRGHSYCAARGEILGPAQDGPERKHLPRM 148 >tpg|DAA15244.1| TPA: hypothetical protein BOS_23187 [Bos taurus] Length = 185 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 269 MIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 MIKRD RGHSYC ARGEILGP+QD +RKHLPRM Sbjct: 1 MIKRDGRGHSYCAARGEILGPAQDGPERKHLPRM 34 >gb|ACQ58312.1| Hemoglobin subunit alpha-2 [Anoplopoma fimbria] Length = 108 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 269 MIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 MIKRD RGHSYC ARGEILGP+QD +RKHLPRM Sbjct: 1 MIKRDGRGHSYCAARGEILGPAQDGRKRKHLPRM 34 >dbj|BAE89779.1| unnamed protein product [Macaca fascicularis] Length = 52 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 269 MIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 MIKRD RGHSYC ARGEILGP+QD +RKHLPRM Sbjct: 1 MIKRDGRGHSYCAARGEILGPAQDGPERKHLPRM 34 >ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter sp. P8-3-8] Length = 121 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 369 ILGKCFRCSSSCDGPRISPLASQYECPRLSLLIITS 262 ILGKCFR SC GPRISPLA+QYECPR SLLI+ S Sbjct: 7 ILGKCFRSGPSCAGPRISPLAAQYECPRPSLLIMAS 42 >gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira oceanica] Length = 104 Score = 49.7 bits (117), Expect(2) = 9e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 263 EVMIKRDRRGHSYCDARGEILGPSQDELQRKHLPRM 370 EVMI RD G+SY RGEILG +DEL RKHLPRM Sbjct: 24 EVMINRDSWGYSYFVVRGEILGFPKDELLRKHLPRM 59 Score = 28.9 bits (63), Expect(2) = 9e-07 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 192 LTLNNLAWNNGIGPRFYFV 248 + LN LAWNN IG R YFV Sbjct: 1 MPLNILAWNNKIGLRNYFV 19