BLASTX nr result
ID: Mentha26_contig00032115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032115 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39312.1| hypothetical protein MIMGU_mgv1a001469mg [Mimulus... 63 5e-08 >gb|EYU39312.1| hypothetical protein MIMGU_mgv1a001469mg [Mimulus guttatus] Length = 813 Score = 62.8 bits (151), Expect = 5e-08 Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 4/101 (3%) Frame = -1 Query: 299 SETSTSASTNEDVESGTHTRPDKAPSAGIDSHMSETVSEFDDANVLSTSHVARSV----H 132 SE S AS + +ES T TRPDK S ++ S ++S+ D+ ++ S S + +V + Sbjct: 168 SEISFDASATKVLESNTPTRPDKLASDSVELKRSHSISDSDELDIPSLSPLNSTVSEVNY 227 Query: 131 RPLVNKIEKTPVTKIDERFTSNNLVDKRKGGRVAVIEEFLP 9 P NKI++T K DE F + ++ D+R AV+E F+P Sbjct: 228 TPQANKIKRTKAAKPDEGFQTTSIKDRRTCSGAAVLEGFVP 268