BLASTX nr result
ID: Mentha26_contig00032063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032063 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349228.1| PREDICTED: uncharacterized protein LOC102584... 66 4e-09 ref|XP_004229426.1| PREDICTED: uncharacterized protein LOC101252... 66 4e-09 ref|XP_002517183.1| conserved hypothetical protein [Ricinus comm... 65 8e-09 ref|XP_006664334.1| PREDICTED: protein YLS7-like [Oryza brachyan... 65 1e-08 ref|XP_002311838.2| hypothetical protein POPTR_0008s20840g [Popu... 65 1e-08 emb|CBI32367.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249... 65 1e-08 emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] 65 1e-08 ref|XP_006479739.1| PREDICTED: protein YLS7-like isoform X1 [Cit... 64 2e-08 ref|XP_006444099.1| hypothetical protein CICLE_v10020003mg [Citr... 64 2e-08 ref|NP_001066145.1| Os12g0145400 [Oryza sativa Japonica Group] g... 64 2e-08 emb|CBX24452.1| hypothetical_protein [Oryza glaberrima] 64 2e-08 gb|EEC68856.1| hypothetical protein OsI_37453 [Oryza sativa Indi... 64 2e-08 ref|XP_006407985.1| hypothetical protein EUTSA_v10020661mg [Eutr... 64 2e-08 ref|XP_004247157.1| PREDICTED: uncharacterized protein LOC101253... 64 2e-08 gb|EYU45620.1| hypothetical protein MIMGU_mgv1a026217mg [Mimulus... 64 3e-08 gb|EXB39359.1| hypothetical protein L484_025054 [Morus notabilis] 64 3e-08 ref|XP_007199837.1| hypothetical protein PRUPE_ppa005573mg [Prun... 64 3e-08 ref|XP_003578929.1| PREDICTED: uncharacterized protein LOC100826... 64 3e-08 gb|EXB55016.1| hypothetical protein L484_007347 [Morus notabilis] 63 4e-08 >ref|XP_006349228.1| PREDICTED: uncharacterized protein LOC102584626 [Solanum tuberosum] Length = 451 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQ 243 QDCSHWCLPGVPD+WNELLYALF+KR A+Q Sbjct: 412 QDCSHWCLPGVPDAWNELLYALFMKREATQ 441 >ref|XP_004229426.1| PREDICTED: uncharacterized protein LOC101252430 [Solanum lycopersicum] Length = 451 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQ 243 QDCSHWCLPGVPD+WNELLYALF+KR A+Q Sbjct: 412 QDCSHWCLPGVPDAWNELLYALFMKREATQ 441 >ref|XP_002517183.1| conserved hypothetical protein [Ricinus communis] gi|223543818|gb|EEF45346.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQ 243 QDCSHWCLPGVPD+WNELLYALFLKR A++ Sbjct: 413 QDCSHWCLPGVPDTWNELLYALFLKREAAK 442 >ref|XP_006664334.1| PREDICTED: protein YLS7-like [Oryza brachyantha] Length = 390 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEH 237 QDCSHWCLPGVPD+WNELLYALFLKR+ H Sbjct: 346 QDCSHWCLPGVPDAWNELLYALFLKRQMVAHH 377 >ref|XP_002311838.2| hypothetical protein POPTR_0008s20840g [Populus trichocarpa] gi|550333564|gb|EEE89205.2| hypothetical protein POPTR_0008s20840g [Populus trichocarpa] Length = 453 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQ 243 QDCSHWCLPGVPDSWNELLYALFLK A Q Sbjct: 413 QDCSHWCLPGVPDSWNELLYALFLKHGAKQ 442 >emb|CBI32367.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRA 249 QDCSHWCLPGVPDSWNELLYALFLKR + Sbjct: 372 QDCSHWCLPGVPDSWNELLYALFLKRES 399 >ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249456 [Vitis vinifera] Length = 460 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRA 249 QDCSHWCLPGVPDSWNELLYALFLKR + Sbjct: 413 QDCSHWCLPGVPDSWNELLYALFLKRES 440 >emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] Length = 463 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRA 249 QDCSHWCLPGVPDSWNELLYALFLKR + Sbjct: 416 QDCSHWCLPGVPDSWNELLYALFLKRES 443 >ref|XP_006479739.1| PREDICTED: protein YLS7-like isoform X1 [Citrus sinensis] Length = 476 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEHL*VGAHKNAP 207 QDCSHWCLPG+PDSWNELLYALFLK+ S V H AP Sbjct: 435 QDCSHWCLPGIPDSWNELLYALFLKQETSHAQNSV-EHPQAP 475 >ref|XP_006444099.1| hypothetical protein CICLE_v10020003mg [Citrus clementina] gi|568852145|ref|XP_006479740.1| PREDICTED: protein YLS7-like isoform X2 [Citrus sinensis] gi|557546361|gb|ESR57339.1| hypothetical protein CICLE_v10020003mg [Citrus clementina] Length = 473 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEHL*VGAHKNAP 207 QDCSHWCLPG+PDSWNELLYALFLK+ S V H AP Sbjct: 432 QDCSHWCLPGIPDSWNELLYALFLKQETSHAQNSV-EHPQAP 472 >ref|NP_001066145.1| Os12g0145400 [Oryza sativa Japonica Group] gi|77553675|gb|ABA96471.1| expressed protein [Oryza sativa Japonica Group] gi|113648652|dbj|BAF29164.1| Os12g0145400 [Oryza sativa Japonica Group] Length = 436 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEH 237 QDCSHWCLPGVPD+WNELLYALFL+R+ H Sbjct: 392 QDCSHWCLPGVPDAWNELLYALFLRRKMVMPH 423 >emb|CBX24452.1| hypothetical_protein [Oryza glaberrima] Length = 436 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEH 237 QDCSHWCLPGVPD+WNELLYALFL+R+ H Sbjct: 392 QDCSHWCLPGVPDAWNELLYALFLRRKMVMPH 423 >gb|EEC68856.1| hypothetical protein OsI_37453 [Oryza sativa Indica Group] gi|222616629|gb|EEE52761.1| hypothetical protein OsJ_35206 [Oryza sativa Japonica Group] Length = 421 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEH 237 QDCSHWCLPGVPD+WNELLYALFL+R+ H Sbjct: 377 QDCSHWCLPGVPDAWNELLYALFLRRKMVMPH 408 >ref|XP_006407985.1| hypothetical protein EUTSA_v10020661mg [Eutrema salsugineum] gi|557109131|gb|ESQ49438.1| hypothetical protein EUTSA_v10020661mg [Eutrema salsugineum] Length = 469 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRAS 246 QDCSHWCLPGVPD+WNELLYALF+K+ AS Sbjct: 423 QDCSHWCLPGVPDTWNELLYALFMKQEAS 451 >ref|XP_004247157.1| PREDICTED: uncharacterized protein LOC101253933 [Solanum lycopersicum] Length = 464 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQEHL 234 QDCSHWCLPGVPDSWNELLYA+ LK+ +QE + Sbjct: 423 QDCSHWCLPGVPDSWNELLYAILLKQELAQEKI 455 >gb|EYU45620.1| hypothetical protein MIMGU_mgv1a026217mg [Mimulus guttatus] Length = 424 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRA 249 QDCSHWCLPGVPD+WNELLYALFLKR + Sbjct: 392 QDCSHWCLPGVPDTWNELLYALFLKRES 419 >gb|EXB39359.1| hypothetical protein L484_025054 [Morus notabilis] Length = 435 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQ 243 QDCSHWCLPGVPDSWNELLYAL LKR S+ Sbjct: 405 QDCSHWCLPGVPDSWNELLYALLLKRELSK 434 >ref|XP_007199837.1| hypothetical protein PRUPE_ppa005573mg [Prunus persica] gi|462395237|gb|EMJ01036.1| hypothetical protein PRUPE_ppa005573mg [Prunus persica] Length = 454 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRA 249 QDCSHWCLPGVPD+WNELLYALFLKR + Sbjct: 417 QDCSHWCLPGVPDAWNELLYALFLKRES 444 >ref|XP_003578929.1| PREDICTED: uncharacterized protein LOC100826602 [Brachypodium distachyon] Length = 468 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQE 240 QDCSHWCLPGVPD+WNELLYA+F+KR+A + Sbjct: 424 QDCSHWCLPGVPDTWNELLYAVFMKRQAMMD 454 >gb|EXB55016.1| hypothetical protein L484_007347 [Morus notabilis] Length = 458 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 332 QDCSHWCLPGVPDSWNELLYALFLKRRASQ 243 QDCSHWCLPGVPD+WNELLYALFLK S+ Sbjct: 414 QDCSHWCLPGVPDTWNELLYALFLKHETSR 443