BLASTX nr result
ID: Mentha26_contig00032040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00032040 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45132.1| hypothetical protein MIMGU_mgv1a022534mg, partial... 58 2e-06 >gb|EYU45132.1| hypothetical protein MIMGU_mgv1a022534mg, partial [Mimulus guttatus] Length = 256 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/64 (43%), Positives = 38/64 (59%) Frame = -2 Query: 439 LTPIIWKDTRAKDTDKSWLPKSITMKKPKVSSDTPQTXXXXXXXXXXXXXXXSDSTDEPV 260 LTP+IWK A +D+SWLPKSI +K+ KVS + +T +DSTDE V Sbjct: 192 LTPVIWKGVDALGSDQSWLPKSIAVKRAKVSPEAAKTSISQQSLAEYLAASFNDSTDEAV 251 Query: 259 DKKP 248 D++P Sbjct: 252 DEQP 255