BLASTX nr result
ID: Mentha26_contig00031963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031963 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39805.1| hypothetical protein MIMGU_mgv1a002856mg [Mimulus... 64 3e-08 gb|EYU39572.1| hypothetical protein MIMGU_mgv1a001895mg [Mimulus... 56 6e-06 >gb|EYU39805.1| hypothetical protein MIMGU_mgv1a002856mg [Mimulus guttatus] Length = 630 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/63 (50%), Positives = 46/63 (73%), Gaps = 8/63 (12%) Frame = +1 Query: 4 NNQDHSPEIQTRKTSLLSRWRDRNK-------DSNDEKSPNE-GQNITVKQDETNGHEVH 159 ++QDHS E+ TRK SLLSRWRD+NK + N+ KS NE ++++++ +ETNGH+V Sbjct: 568 SDQDHSQEMPTRKISLLSRWRDKNKEKSSGVEEQNEGKSSNEDNRSLSLENEETNGHKVD 627 Query: 160 EKV 168 EKV Sbjct: 628 EKV 630 >gb|EYU39572.1| hypothetical protein MIMGU_mgv1a001895mg [Mimulus guttatus] Length = 743 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 14/68 (20%) Frame = +1 Query: 4 NNQDHSPEI-QTRKTSLLSR-----WRDRNK--------DSNDEKSPNEGQNITVKQDET 141 NNQ+ S +I RK SLLSR WRDRNK +N + S NEG+ +++KQ+E+ Sbjct: 675 NNQESSQDIIPPRKISLLSRPFGLGWRDRNKGKPVIVEEQTNGKSSSNEGEKLSLKQEES 734 Query: 142 NGHEVHEK 165 NGH+V EK Sbjct: 735 NGHQVEEK 742