BLASTX nr result
ID: Mentha26_contig00031887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031887 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001091804.1| thioredoxin-like protein [Bombyx mori] gi|11... 57 2e-06 gb|EFX83063.1| hypothetical protein DAPPUDRAFT_230730 [Daphnia p... 57 4e-06 gb|AAF14217.1|AF107490_1 thioredoxin [Fasciola hepatica] 56 5e-06 pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thiored... 56 5e-06 >ref|NP_001091804.1| thioredoxin-like protein [Bombyx mori] gi|116272511|gb|ABJ97191.1| thioredoxin-like protein [Bombyx mori] gi|124127033|gb|ABM92269.1| thioredoxin [Bombyx mori] Length = 106 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -2 Query: 378 DEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLREAITTNK 241 DE ED AS Y ++ MPTF+F+KNGKKL E GAN KL+ I +K Sbjct: 61 DECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVDKLKTTILKHK 106 >gb|EFX83063.1| hypothetical protein DAPPUDRAFT_230730 [Daphnia pulex] Length = 105 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -2 Query: 378 DEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLREAITTNK 241 DE ED AS Y + MPTF++LKNG K+ E GANE +LR+ I +K Sbjct: 60 DECEDVASDYNISCMPTFLYLKNGAKVAEFSGANEEQLRKLIDQHK 105 >gb|AAF14217.1|AF107490_1 thioredoxin [Fasciola hepatica] Length = 104 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -2 Query: 378 DEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLREAITTNK 241 D+ E+ A+ Y V MPTF+F+K+GK++ GANE+KLRE IT +K Sbjct: 59 DQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK 104 >pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin gi|6687568|emb|CAB65014.1| thioredoxin (TRX) [Fasciola hepatica] Length = 104 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -2 Query: 378 DEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLREAITTNK 241 D+ E+ A+ Y V MPTF+F+K+GK++ GANE+KLRE IT +K Sbjct: 59 DQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK 104