BLASTX nr result
ID: Mentha26_contig00031875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031875 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45386.1| hypothetical protein MIMGU_mgv1a012288mg [Mimulus... 74 2e-11 >gb|EYU45386.1| hypothetical protein MIMGU_mgv1a012288mg [Mimulus guttatus] gi|604347083|gb|EYU45387.1| hypothetical protein MIMGU_mgv1a012288mg [Mimulus guttatus] Length = 255 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -1 Query: 434 MASKLWKNDDRKISKWPKYRESGYLLPTAQSKRILTSEGSRCQFV 300 +A+KLW+N++RKISKWPK +ESG LLPT Q+KR +T EGSRCQFV Sbjct: 211 VAAKLWRNEERKISKWPKCKESGCLLPTVQNKRSVTGEGSRCQFV 255