BLASTX nr result
ID: Mentha26_contig00031473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031473 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20252.1| hypothetical protein MIMGU_mgv1a001677mg [Mimulus... 56 5e-06 >gb|EYU20252.1| hypothetical protein MIMGU_mgv1a001677mg [Mimulus guttatus] Length = 774 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -1 Query: 110 SQLCYSSAKWKHKRVEFLKPHGRESHFSWIVKSVLN 3 SQLC S KWK R+EFLKPH R S + WIVKSVLN Sbjct: 18 SQLCCSGLKWKQTRLEFLKPHRRNSQYLWIVKSVLN 53