BLASTX nr result
ID: Mentha26_contig00031200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031200 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32418.1| hypothetical protein MIMGU_mgv1a024723mg, partial... 58 2e-06 >gb|EYU32418.1| hypothetical protein MIMGU_mgv1a024723mg, partial [Mimulus guttatus] Length = 577 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 173 TKMSKSDVEMEDAEKLHNDSGNNVQESECKVTDPKVERE-EEGPCAASAS 319 +KMSKSDVEMEDAEKL NDSGNNV+E K D VE E E+ PC A+ S Sbjct: 1 SKMSKSDVEMEDAEKLPNDSGNNVEEG--KSVDASVETEGEKIPCPAAVS 48