BLASTX nr result
ID: Mentha26_contig00031130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031130 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18079.1| hypothetical protein MIMGU_mgv1a000581mg [Mimulus... 63 5e-08 >gb|EYU18079.1| hypothetical protein MIMGU_mgv1a000581mg [Mimulus guttatus] Length = 1060 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 344 LGSILTDGQVGRFGDMLPAQAAGLLSSFTAGRSD 243 LGS+LTDGQVGRFGD+LPAQAAGLLSSFT RSD Sbjct: 1026 LGSMLTDGQVGRFGDILPAQAAGLLSSFTTARSD 1059