BLASTX nr result
ID: Mentha26_contig00031107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031107 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_734017.2| RNA-dependent RNA polymerase [Cycas necrotic st... 86 5e-15 ref|NP_620619.1| polyprotien 1 [Cycas necrotic stunt virus] gi|5... 86 5e-15 gb|AEN25475.1| polyprotein 1, partial [Cycas necrotic stunt virus] 82 1e-13 >ref|NP_734017.2| RNA-dependent RNA polymerase [Cycas necrotic stunt virus] Length = 846 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 397 TSSNSVEKAFSQCWAMRCAPNSSSRKVTFEPDWRKNKFLGIS 272 TSS+S+ KAFSQCWAMRCAPNSSSRKVTFEP+WRKNKFLGIS Sbjct: 805 TSSDSIAKAFSQCWAMRCAPNSSSRKVTFEPEWRKNKFLGIS 846 >ref|NP_620619.1| polyprotien 1 [Cycas necrotic stunt virus] gi|50400776|sp|Q8QVV0.1|POL1_CNSV RecName: Full=RNA1 polyprotein; AltName: Full=P1; Contains: RecName: Full=P1A protein; Short=1A; AltName: Full=Protease cofactor; Contains: RecName: Full=Putative ATP-dependent helicase; AltName: Full=1B; AltName: Full=Membrane-binding protein; AltName: Full=NTP-binding protein; Short=NTB; Contains: RecName: Full=Viral genome-linked protein; AltName: Full=1C-VPg; Contains: RecName: Full=Picornain 3C-like protease; Short=3C-like protease; AltName: Full=1D-PRO; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=1E-POL gi|20160382|dbj|BAB89369.1| polyprotien 1 [Cycas necrotic stunt virus] Length = 2336 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 397 TSSNSVEKAFSQCWAMRCAPNSSSRKVTFEPDWRKNKFLGIS 272 TSS+S+ KAFSQCWAMRCAPNSSSRKVTFEP+WRKNKFLGIS Sbjct: 2295 TSSDSIAKAFSQCWAMRCAPNSSSRKVTFEPEWRKNKFLGIS 2336 >gb|AEN25475.1| polyprotein 1, partial [Cycas necrotic stunt virus] Length = 1984 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 397 TSSNSVEKAFSQCWAMRCAPNSSSRKVTFEPDWRKNKFLGIS 272 TSS+++ KAFSQCWAMRCAPNSSSRK+TFEP+WRKNK LGIS Sbjct: 1943 TSSDTIAKAFSQCWAMRCAPNSSSRKITFEPEWRKNKVLGIS 1984