BLASTX nr result
ID: Mentha26_contig00031012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00031012 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308315.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004231209.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_002523370.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_004308315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 910 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/71 (45%), Positives = 39/71 (54%), Gaps = 6/71 (8%) Frame = -1 Query: 203 PPAPSFSDT------LSNVSSFSKFNPAKARHAQIIKLSGEGDSDIKVQSLITSYLELGD 42 P PS S T L + N KA HAQ+IK+S D+K +SL+T YLE GD Sbjct: 19 PSLPSLSSTFTLLDDLGQLGELKSLNSVKAVHAQMIKMSNNNKMDVKGKSLVTYYLEFGD 78 Query: 41 FHSAAMVFFIG 9 SAAM FF+G Sbjct: 79 PRSAAMAFFVG 89 >ref|XP_004231209.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Solanum lycopersicum] Length = 929 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 8/72 (11%) Frame = -1 Query: 200 PAPSFSDTLSNVSS--------FSKFNPAKARHAQIIKLSGEGDSDIKVQSLITSYLELG 45 P S S +L ++SS F+ N +A HA++IKLS E D+ +Q I+ YLE G Sbjct: 37 PESSLSTSLESLSSLQFDYENKFNSLNSVRAMHAKMIKLSNEWDTKKNMQYFISGYLEFG 96 Query: 44 DFHSAAMVFFIG 9 DF SAA++FF+G Sbjct: 97 DFQSAAVLFFVG 108 >ref|XP_002523370.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537458|gb|EEF39086.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -1 Query: 182 DTLSNVSSFSKFNPAKARHAQIIKLSGEGDSDIKVQSLITSYLELGDFHSAAMVFFIG 9 D+ S+V + N A HAQ+IK +SD ++LITSYLELGDF S+AMVFF+G Sbjct: 70 DSSSDVKTLDSIN---AMHAQLIKTCSMWNSDSNARTLITSYLELGDFRSSAMVFFVG 124