BLASTX nr result
ID: Mentha26_contig00030828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030828 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71001.1| hypothetical protein M569_03747 [Genlisea aurea] 60 2e-07 >gb|EPS71001.1| hypothetical protein M569_03747 [Genlisea aurea] Length = 530 Score = 60.5 bits (145), Expect = 2e-07 Identities = 39/84 (46%), Positives = 48/84 (57%) Frame = +2 Query: 65 IRFRTVGKASANENPSTIPEKPKPPVAGNRVEDSDPLPDPDRNLFSSVMHLLRAEIKVDG 244 IR + +ASANENPSTIP+KP P ++DPL S + LR KVDG Sbjct: 54 IRRFPLTRASANENPSTIPDKPNP--------ETDPL--------SLSLLGLRQMFKVDG 97 Query: 245 LGMDILSIAVPXXXXXXXDPITSL 316 LG++ILSIA+P DP TSL Sbjct: 98 LGLEILSIAMPAALALAADPFTSL 121