BLASTX nr result
ID: Mentha26_contig00030814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030814 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30704.1| hypothetical protein MIMGU_mgv1a004738mg [Mimulus... 98 1e-18 >gb|EYU30704.1| hypothetical protein MIMGU_mgv1a004738mg [Mimulus guttatus] gi|604319513|gb|EYU30705.1| hypothetical protein MIMGU_mgv1a004738mg [Mimulus guttatus] Length = 512 Score = 98.2 bits (243), Expect = 1e-18 Identities = 50/78 (64%), Positives = 61/78 (78%) Frame = +3 Query: 228 MTKPVALPLAFRISSRPTKFLSQFNAPKPVSVVAGCHLILGSNKRGTSHKFRFLGTNNCI 407 M KP +LPLAFRISSRPTK QF APKP+S++AGC+LILG NKR S +F+FLG+ NC+ Sbjct: 1 MAKPASLPLAFRISSRPTKMPKQFIAPKPISLIAGCNLILGLNKR-NSGQFQFLGSRNCV 59 Query: 408 SNPFLNCSLLGTRSFSSS 461 + N SLLG RSFSS+ Sbjct: 60 RSFCSNYSLLGMRSFSSN 77