BLASTX nr result
ID: Mentha26_contig00030649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030649 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14900.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 2e-06 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = +3 Query: 3 GNDARWRLLVKKVVLARTISSLSIPKRKREDAPRISL-HRE---SFRL 134 G DARW+LLV+KVV A+ +SSLS+PKRKRE+ PR +L HR SFRL Sbjct: 300 GEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFRL 347 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = +3 Query: 3 GNDARWRLLVKKVVLARTISSLSIPKRKREDAPRISL-HRE---SFRL 134 G DARW+LLV+KVV A+ +SSLS+PKRKRE+ PR +L HR SFRL Sbjct: 304 GEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFRL 351