BLASTX nr result
ID: Mentha26_contig00030637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030637 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29518.1| hypothetical protein MIMGU_mgv1a004287mg [Mimulus... 68 1e-09 gb|EYU29940.1| hypothetical protein MIMGU_mgv1a022403mg [Mimulus... 65 1e-08 ref|XP_002300134.2| hypothetical protein POPTR_0001s33190g [Popu... 62 6e-08 gb|EYU29522.1| hypothetical protein MIMGU_mgv1a0042561mg, partia... 58 1e-06 ref|XP_006283512.1| hypothetical protein CARUB_v10004564mg [Caps... 57 3e-06 ref|XP_004492989.1| PREDICTED: acyltransferase-like protein At3g... 55 8e-06 >gb|EYU29518.1| hypothetical protein MIMGU_mgv1a004287mg [Mimulus guttatus] Length = 535 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = -3 Query: 403 TFSDNGDPLFLVRKQFHSTQDDKFDLVAAIKCASYYRRGGTLDYITDFVPPSPSELKSV 227 +F NGDPLFL DD FDL AAIK ASYYRRG ++D+I+DF+PPSPSE V Sbjct: 273 SFIGNGDPLFL---------DDTFDLAAAIKRASYYRRGRSVDFISDFMPPSPSEFDMV 322 >gb|EYU29940.1| hypothetical protein MIMGU_mgv1a022403mg [Mimulus guttatus] Length = 622 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = -3 Query: 397 SDNGDPLFLVRKQFHSTQDDKFDLVAAIKCASYYRRGGTLDYITDFVPPSPSELKSVCE 221 S NG+PLFL D+ FDLVA IK SYYRRG ++DY++DF PP+PSEL + E Sbjct: 281 SGNGNPLFL---------DETFDLVATIKRVSYYRRGASVDYMSDFFPPTPSELNMILE 330 >ref|XP_002300134.2| hypothetical protein POPTR_0001s33190g [Populus trichocarpa] gi|550348759|gb|EEE84939.2| hypothetical protein POPTR_0001s33190g [Populus trichocarpa] Length = 579 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = -3 Query: 400 FSDNGDPLFLVRKQFHSTQDDKFDLVAAIKCASYYRRGGTLDYITDFVPPSPSELKSVCE 221 F+DNG LFL +D DLV IK AS+YRRG DY+ D++PP+PSE+K++CE Sbjct: 238 FNDNGHYLFL---------EDGVDLVTVIKGASFYRRGKCHDYVFDYIPPTPSEIKNICE 288 >gb|EYU29522.1| hypothetical protein MIMGU_mgv1a0042561mg, partial [Mimulus guttatus] Length = 482 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = -3 Query: 403 TFSDNGDPLFLVRKQFHSTQDDKFDLVAAIKCASYYRRGGTLDYITDFVPPSPSELKSV 227 +F + DPLF D+ FDLVA IK +YYRRG +++Y DF PP+PSELK++ Sbjct: 138 SFVHHRDPLF---------SDETFDLVATIKRVNYYRRGASVEYFLDFFPPTPSELKTI 187 >ref|XP_006283512.1| hypothetical protein CARUB_v10004564mg [Capsella rubella] gi|482552217|gb|EOA16410.1| hypothetical protein CARUB_v10004564mg [Capsella rubella] Length = 533 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/56 (46%), Positives = 37/56 (66%) Frame = -3 Query: 400 FSDNGDPLFLVRKQFHSTQDDKFDLVAAIKCASYYRRGGTLDYITDFVPPSPSELK 233 + +NG LFL +D DL+ IKC+ YYRRG +LDY++D++PP+P ELK Sbjct: 336 YENNGQLLFL---------EDGLDLLTIIKCSYYYRRGKSLDYVSDYIPPTPFELK 382 >ref|XP_004492989.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like [Cicer arietinum] Length = 659 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = -3 Query: 400 FSDNGDPLFLVRKQFHSTQDDKFDLVAAIKCASYYRRGGTLDYITDFVPPSPSELKSVCE 221 F+D+G LFL Q+ DLV +K SYYRRG DY++DFVPP+P E K V E Sbjct: 316 FNDSGHFLFL--------QEGSIDLVTILKGTSYYRRGKYHDYVSDFVPPTPDEAKEVIE 367