BLASTX nr result
ID: Mentha26_contig00030507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030507 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39691.1| hypothetical protein MIMGU_mgv1a008397mg [Mimulus... 75 7e-12 >gb|EYU39691.1| hypothetical protein MIMGU_mgv1a008397mg [Mimulus guttatus] Length = 375 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/74 (54%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = -3 Query: 214 MNCLQHLTRTSALPLQSLSGIYSGKPSCAVTSLAMVKGTGLSRRSIVVAEAASGSVPSTD 35 MNCLQ+L R+SA PLQ+L P C V L +V G G SR IVVA+A SGS PS + Sbjct: 1 MNCLQNLPRSSAFPLQNLKSYSGRNPPCHVNILGIVNGVGSSRNRIVVAKAVSGSAPSAE 60 Query: 34 NETG---EKSETYS 2 N+T EKS+TYS Sbjct: 61 NQTSKMDEKSDTYS 74