BLASTX nr result
ID: Mentha26_contig00030440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030440 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006375092.1| hypothetical protein POPTR_0014s04290g [Popu... 57 3e-06 ref|XP_007032855.1| Phosphatidylinositol N-acetylglucosaminyltra... 56 6e-06 >ref|XP_006375092.1| hypothetical protein POPTR_0014s04290g [Populus trichocarpa] gi|550323406|gb|ERP52889.1| hypothetical protein POPTR_0014s04290g [Populus trichocarpa] Length = 154 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 202 VSGERGTMLSDVYGFMGSITVVVAVGIFMIWAYVPE 309 VSG+ GT S+VYGF+GSIT VVA IF++WAYVPE Sbjct: 28 VSGDHGTKSSEVYGFLGSITTVVATVIFLVWAYVPE 63 >ref|XP_007032855.1| Phosphatidylinositol N-acetylglucosaminyltransferase subunit P [Theobroma cacao] gi|508711884|gb|EOY03781.1| Phosphatidylinositol N-acetylglucosaminyltransferase subunit P [Theobroma cacao] Length = 211 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 202 VSGERGTMLSDVYGFMGSITVVVAVGIFMIWAYVPE 309 VSGE G S+VYGF+GSIT VVA IF++WAY+PE Sbjct: 81 VSGEHGPKPSEVYGFVGSITTVVATAIFLVWAYIPE 116