BLASTX nr result
ID: Mentha26_contig00030311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030311 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31690.1| hypothetical protein MIMGU_mgv1a003053mg [Mimulus... 57 2e-06 >gb|EYU31690.1| hypothetical protein MIMGU_mgv1a003053mg [Mimulus guttatus] Length = 611 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +2 Query: 167 MPATWSESVEKAPTGGGVGATS---RSAYVPPHLRNR 268 MP +WS+S+E+ PTGGGVG TS RS+YVPPHLRNR Sbjct: 1 MPTSWSDSMERLPTGGGVGNTSRAPRSSYVPPHLRNR 37