BLASTX nr result
ID: Mentha26_contig00030137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030137 (627 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356768.1| PREDICTED: transcriptional corepressor LEUNI... 66 7e-09 ref|XP_006352696.1| PREDICTED: transcriptional corepressor LEUNI... 66 7e-09 gb|EPS70716.1| hypothetical protein M569_04039 [Genlisea aurea] 66 7e-09 ref|XP_004247088.1| PREDICTED: transcriptional corepressor LEUNI... 66 7e-09 ref|XP_004242402.1| PREDICTED: transcriptional corepressor LEUNI... 66 7e-09 emb|CAF18246.1| STY-L protein [Antirrhinum majus] 66 7e-09 ref|XP_002521103.1| WD-repeat protein, putative [Ricinus communi... 65 2e-08 ref|XP_007049791.1| WD-repeat protein isoform 2 [Theobroma cacao... 63 6e-08 ref|XP_007049790.1| WD-repeat protein isoform 1 [Theobroma cacao... 63 6e-08 ref|XP_002266172.1| PREDICTED: transcriptional corepressor LEUNI... 63 6e-08 emb|CAN73936.1| hypothetical protein VITISV_026282 [Vitis vinifera] 63 6e-08 ref|XP_002301780.1| WD-40 repeat family protein [Populus trichoc... 63 8e-08 gb|EXC24195.1| Transcriptional corepressor LEUNIG [Morus notabilis] 61 2e-07 ref|XP_006479291.1| PREDICTED: transcriptional corepressor LEUNI... 61 2e-07 ref|XP_006479287.1| PREDICTED: transcriptional corepressor LEUNI... 61 2e-07 ref|XP_006479286.1| PREDICTED: transcriptional corepressor LEUNI... 61 2e-07 ref|XP_006588999.1| PREDICTED: transcriptional corepressor LEUNI... 60 4e-07 ref|XP_006588998.1| PREDICTED: transcriptional corepressor LEUNI... 60 4e-07 ref|XP_006588997.1| PREDICTED: transcriptional corepressor LEUNI... 60 4e-07 ref|XP_006588996.1| PREDICTED: transcriptional corepressor LEUNI... 60 4e-07 >ref|XP_006356768.1| PREDICTED: transcriptional corepressor LEUNIG-like [Solanum tuberosum] Length = 765 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 30 >ref|XP_006352696.1| PREDICTED: transcriptional corepressor LEUNIG-like [Solanum tuberosum] Length = 776 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 30 >gb|EPS70716.1| hypothetical protein M569_04039 [Genlisea aurea] Length = 772 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 30 >ref|XP_004247088.1| PREDICTED: transcriptional corepressor LEUNIG-like [Solanum lycopersicum] Length = 762 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 30 >ref|XP_004242402.1| PREDICTED: transcriptional corepressor LEUNIG-like [Solanum lycopersicum] Length = 776 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 30 >emb|CAF18246.1| STY-L protein [Antirrhinum majus] Length = 777 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 30 >ref|XP_002521103.1| WD-repeat protein, putative [Ricinus communis] gi|223539672|gb|EEF41254.1| WD-repeat protein, putative [Ricinus communis] Length = 766 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQ+NWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 1 MAQNNWEADKMLDVYIHDYLLKRKLHNSAK 30 >ref|XP_007049791.1| WD-repeat protein isoform 2 [Theobroma cacao] gi|508702052|gb|EOX93948.1| WD-repeat protein isoform 2 [Theobroma cacao] Length = 784 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLH SAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHASAK 30 >ref|XP_007049790.1| WD-repeat protein isoform 1 [Theobroma cacao] gi|508702051|gb|EOX93947.1| WD-repeat protein isoform 1 [Theobroma cacao] Length = 783 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLH SAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHASAK 30 >ref|XP_002266172.1| PREDICTED: transcriptional corepressor LEUNIG [Vitis vinifera] gi|297744346|emb|CBI37316.3| unnamed protein product [Vitis vinifera] Length = 779 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLH SAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHASAK 30 >emb|CAN73936.1| hypothetical protein VITISV_026282 [Vitis vinifera] Length = 774 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYIHDYLLKRKLH SAK Sbjct: 1 MAQSNWEADKMLDVYIHDYLLKRKLHASAK 30 >ref|XP_002301780.1| WD-40 repeat family protein [Populus trichocarpa] gi|222843506|gb|EEE81053.1| WD-40 repeat family protein [Populus trichocarpa] Length = 777 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 543 QSNWEADKMLDVYIHDYLLKRKLHNSAK 626 QSNWEADKMLDVYIHDYLLKRKLHNSAK Sbjct: 4 QSNWEADKMLDVYIHDYLLKRKLHNSAK 31 >gb|EXC24195.1| Transcriptional corepressor LEUNIG [Morus notabilis] Length = 771 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQ+NWEADKMLDVYIHDY LKRKLH SAK Sbjct: 1 MAQNNWEADKMLDVYIHDYFLKRKLHTSAK 30 >ref|XP_006479291.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X6 [Citrus sinensis] Length = 782 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 534 IMAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 +MAQ NWEADKMLDVYIHDY LKRKLH SAK Sbjct: 25 VMAQGNWEADKMLDVYIHDYFLKRKLHASAK 55 >ref|XP_006479287.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 [Citrus sinensis] Length = 809 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 534 IMAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 +MAQ NWEADKMLDVYIHDY LKRKLH SAK Sbjct: 25 VMAQGNWEADKMLDVYIHDYFLKRKLHASAK 55 >ref|XP_006479286.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 [Citrus sinensis] Length = 810 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 534 IMAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 +MAQ NWEADKMLDVYIHDY LKRKLH SAK Sbjct: 25 VMAQGNWEADKMLDVYIHDYFLKRKLHASAK 55 >ref|XP_006588999.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 [Glycine max] Length = 783 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYI+DYL+K+KLHN+AK Sbjct: 1 MAQSNWEADKMLDVYIYDYLVKKKLHNTAK 30 >ref|XP_006588998.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 [Glycine max] Length = 784 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYI+DYL+K+KLHN+AK Sbjct: 1 MAQSNWEADKMLDVYIYDYLVKKKLHNTAK 30 >ref|XP_006588997.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 [Glycine max] Length = 785 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYI+DYL+K+KLHN+AK Sbjct: 1 MAQSNWEADKMLDVYIYDYLVKKKLHNTAK 30 >ref|XP_006588996.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 [Glycine max] Length = 786 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 537 MAQSNWEADKMLDVYIHDYLLKRKLHNSAK 626 MAQSNWEADKMLDVYI+DYL+K+KLHN+AK Sbjct: 1 MAQSNWEADKMLDVYIYDYLVKKKLHNTAK 30