BLASTX nr result
ID: Mentha26_contig00030055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00030055 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Pop... 90 3e-27 ref|XP_001778695.1| predicted protein [Physcomitrella patens] gi... 89 5e-27 ref|XP_001772217.1| predicted protein [Physcomitrella patens] gi... 89 5e-27 ref|XP_001765848.1| predicted protein [Physcomitrella patens] gi... 89 5e-27 ref|XP_003538340.1| PREDICTED: 26S protease regulatory subunit 6... 90 7e-27 ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6... 90 7e-27 ref|XP_007010399.1| Regulatory particle triple-A ATPase 3 isofor... 90 7e-27 ref|XP_004500390.1| PREDICTED: 26S protease regulatory subunit 6... 90 7e-27 ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6... 90 7e-27 gb|AFK43608.1| unknown [Medicago truncatula] 90 7e-27 ref|XP_003600548.1| 26S protease regulatory subunit 6B [Medicago... 90 7e-27 ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6... 90 7e-27 ref|XP_002322593.1| 26S proteasome subunit 7 family protein [Pop... 90 7e-27 ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citr... 90 7e-27 emb|CBI15803.3| unnamed protein product [Vitis vinifera] 90 7e-27 ref|XP_007010400.1| Regulatory particle triple-A ATPase 3 isofor... 90 7e-27 emb|CAA06853.1| 26S protease regulatory subunit 6 [Cicer arietinum] 90 7e-27 gb|EEC73047.1| hypothetical protein OsI_06998 [Oryza sativa Indi... 87 1e-26 ref|XP_001759290.1| predicted protein [Physcomitrella patens] gi... 88 1e-26 ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative... 90 2e-26 >ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Populus trichocarpa] gi|550335334|gb|EEE91468.2| 26S proteasome subunit 7 family protein [Populus trichocarpa] Length = 384 Score = 89.7 bits (221), Expect(2) = 3e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 343 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 384 Score = 57.8 bits (138), Expect(2) = 3e-27 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVDMEDYVSRPDKISAAE Sbjct: 313 VCTAKMNLSDEVDMEDYVSRPDKISAAE 340 >ref|XP_001778695.1| predicted protein [Physcomitrella patens] gi|162669910|gb|EDQ56488.1| predicted protein [Physcomitrella patens] Length = 416 Score = 89.0 bits (219), Expect(2) = 5e-27 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKK DTDFEFYR Sbjct: 375 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKSDTDFEFYR 416 Score = 57.8 bits (138), Expect(2) = 5e-27 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLSEEVD+EDYVSRPDKISAAE Sbjct: 345 VCTAKMNLSEEVDLEDYVSRPDKISAAE 372 >ref|XP_001772217.1| predicted protein [Physcomitrella patens] gi|162676548|gb|EDQ63030.1| predicted protein [Physcomitrella patens] Length = 412 Score = 89.0 bits (219), Expect(2) = 5e-27 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKK DTDFEFYR Sbjct: 371 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKSDTDFEFYR 412 Score = 57.8 bits (138), Expect(2) = 5e-27 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLSEEVD+EDYVSRPDKISAAE Sbjct: 341 VCTAKMNLSEEVDLEDYVSRPDKISAAE 368 >ref|XP_001765848.1| predicted protein [Physcomitrella patens] gi|162683025|gb|EDQ69439.1| predicted protein [Physcomitrella patens] Length = 387 Score = 89.0 bits (219), Expect(2) = 5e-27 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKK DTDFEFYR Sbjct: 346 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKSDTDFEFYR 387 Score = 57.8 bits (138), Expect(2) = 5e-27 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLSEEVD+EDYVSRPDKISAAE Sbjct: 316 VCTAKMNLSEEVDLEDYVSRPDKISAAE 343 >ref|XP_003538340.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine max] Length = 423 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 382 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 423 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 352 VCTAKMNLSDEVDLEDYVSRPDKISAAE 379 >ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine max] Length = 422 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 381 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 422 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 351 VCTAKMNLSDEVDLEDYVSRPDKISAAE 378 >ref|XP_007010399.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao] gi|508727312|gb|EOY19209.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao] Length = 419 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 378 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 419 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 348 VCTAKMNLSDEVDLEDYVSRPDKISAAE 375 >ref|XP_004500390.1| PREDICTED: 26S protease regulatory subunit 6B homolog isoform X2 [Cicer arietinum] Length = 418 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 377 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 347 VCTAKMNLSDEVDLEDYVSRPDKISAAE 374 >ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6B homolog [Vitis vinifera] Length = 418 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 377 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 347 VCTAKMNLSDEVDLEDYVSRPDKISAAE 374 >gb|AFK43608.1| unknown [Medicago truncatula] Length = 415 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 374 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 344 VCTAKMNLSDEVDLEDYVSRPDKISAAE 371 >ref|XP_003600548.1| 26S protease regulatory subunit 6B [Medicago truncatula] gi|355489596|gb|AES70799.1| 26S protease regulatory subunit 6B [Medicago truncatula] Length = 415 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 374 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 344 VCTAKMNLSDEVDLEDYVSRPDKISAAE 371 >ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Citrus sinensis] Length = 412 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 371 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 341 VCTAKMNLSDEVDLEDYVSRPDKISAAE 368 >ref|XP_002322593.1| 26S proteasome subunit 7 family protein [Populus trichocarpa] gi|118489637|gb|ABK96620.1| unknown [Populus trichocarpa x Populus deltoides] gi|222867223|gb|EEF04354.1| 26S proteasome subunit 7 family protein [Populus trichocarpa] Length = 412 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 371 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 341 VCTAKMNLSDEVDLEDYVSRPDKISAAE 368 >ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citrus clementina] gi|557534172|gb|ESR45290.1| hypothetical protein CICLE_v10003767mg [Citrus clementina] Length = 395 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 354 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 395 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 324 VCTAKMNLSDEVDLEDYVSRPDKISAAE 351 >emb|CBI15803.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 287 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 328 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 257 VCTAKMNLSDEVDLEDYVSRPDKISAAE 284 >ref|XP_007010400.1| Regulatory particle triple-A ATPase 3 isoform 2, partial [Theobroma cacao] gi|508727313|gb|EOY19210.1| Regulatory particle triple-A ATPase 3 isoform 2, partial [Theobroma cacao] Length = 291 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 250 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 291 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 220 VCTAKMNLSDEVDLEDYVSRPDKISAAE 247 >emb|CAA06853.1| 26S protease regulatory subunit 6 [Cicer arietinum] Length = 177 Score = 89.7 bits (221), Expect(2) = 7e-27 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 136 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 177 Score = 56.6 bits (135), Expect(2) = 7e-27 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLS+EVD+EDYVSRPDKISAAE Sbjct: 106 VCTAKMNLSDEVDLEDYVSRPDKISAAE 133 >gb|EEC73047.1| hypothetical protein OsI_06998 [Oryza sativa Indica Group] gi|222622734|gb|EEE56866.1| hypothetical protein OsJ_06499 [Oryza sativa Japonica Group] Length = 442 Score = 87.0 bits (214), Expect(2) = 1e-26 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKP+TDF+FY+ Sbjct: 401 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 442 Score = 58.5 bits (140), Expect(2) = 1e-26 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAEPYAK 98 VCTAKMNLS+EVD+EDYVSRPDKISAA+P ++ Sbjct: 348 VCTAKMNLSDEVDLEDYVSRPDKISAADPMSE 379 >ref|XP_001759290.1| predicted protein [Physcomitrella patens] gi|162689603|gb|EDQ75974.1| predicted protein [Physcomitrella patens] Length = 412 Score = 87.8 bits (216), Expect(2) = 1e-26 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYRSNV+K DTDFEFYR Sbjct: 371 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVRKSDTDFEFYR 412 Score = 57.8 bits (138), Expect(2) = 1e-26 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCTAKMNLSEEVD+EDYVSRPDKISAAE Sbjct: 341 VCTAKMNLSEEVDLEDYVSRPDKISAAE 368 >ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] gi|223537064|gb|EEF38699.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] Length = 415 Score = 89.7 bits (221), Expect(2) = 2e-26 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 86 AICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYR 211 AICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFY+ Sbjct: 374 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415 Score = 55.5 bits (132), Expect(2) = 2e-26 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 3 VCTAKMNLSEEVDMEDYVSRPDKISAAE 86 VCT+KMNLS+EVD+EDYVSRPDKISAAE Sbjct: 344 VCTSKMNLSDEVDLEDYVSRPDKISAAE 371