BLASTX nr result
ID: Mentha26_contig00029599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00029599 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252612.1| PREDICTED: uncharacterized protein LOC101247... 58 1e-06 gb|EYU23332.1| hypothetical protein MIMGU_mgv1a003293mg [Mimulus... 57 2e-06 ref|XP_006360715.1| PREDICTED: uncharacterized protein LOC102580... 57 3e-06 >ref|XP_004252612.1| PREDICTED: uncharacterized protein LOC101247896 [Solanum lycopersicum] Length = 610 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 ENLEEKWRLQAEANDEAERLLSSEPIQSDQVSE 99 ENLEEKW++QAEANDEAERLLSSEP+ ++ VSE Sbjct: 577 ENLEEKWKIQAEANDEAERLLSSEPLTTENVSE 609 >gb|EYU23332.1| hypothetical protein MIMGU_mgv1a003293mg [Mimulus guttatus] Length = 594 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 ENLEEKWRLQAEANDEAERLLSSEPIQSDQ 90 ENLEEKWRLQ EANDEAERLLSSEP+ +DQ Sbjct: 563 ENLEEKWRLQVEANDEAERLLSSEPVPADQ 592 >ref|XP_006360715.1| PREDICTED: uncharacterized protein LOC102580131 [Solanum tuberosum] Length = 565 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +1 Query: 1 ENLEEKWRLQAEANDEAERLLSSEPIQSDQVSE 99 ENLE+KW++QAEANDEAERLLSSEP+ ++ VSE Sbjct: 532 ENLEDKWKIQAEANDEAERLLSSEPLTTENVSE 564