BLASTX nr result
ID: Mentha26_contig00029595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00029595 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18640.1| hypothetical protein MIMGU_mgv1a019403mg, partial... 68 1e-09 >gb|EYU18640.1| hypothetical protein MIMGU_mgv1a019403mg, partial [Mimulus guttatus] Length = 451 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/85 (42%), Positives = 55/85 (64%) Frame = -1 Query: 486 FNADRFHVLSMFRGREDEDDDLSLVMYLPGRDKAGKGLIIYD*TEYLTIKSKLKKVHSPV 307 + +++ +LS+ E + DL++V+Y PGR ++GKGL+ T L +S +K +HSPV Sbjct: 372 WRVEKYRILSVILDGESLEGDLAVVIYCPGRARSGKGLL----TCNLRTES-IKNIHSPV 426 Query: 306 LHGWDRRQFEEEGFQVVHPLIRAKF 232 GWD + EE+G+ VVHPL R KF Sbjct: 427 -GGWDLKLLEEKGYSVVHPLFRTKF 450