BLASTX nr result
ID: Mentha26_contig00029406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00029406 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28494.1| hypothetical protein MIMGU_mgv1a010068mg [Mimulus... 71 2e-10 ref|XP_006364853.1| PREDICTED: uncharacterized protein LOC102579... 71 2e-10 ref|XP_004237910.1| PREDICTED: uncharacterized protein LOC101254... 71 2e-10 gb|EPS64805.1| hypothetical protein M569_09975, partial [Genlise... 60 4e-07 ref|XP_002301052.1| hypothetical protein POPTR_0002s09690g [Popu... 58 2e-06 ref|XP_002513919.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >gb|EYU28494.1| hypothetical protein MIMGU_mgv1a010068mg [Mimulus guttatus] Length = 323 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 AMERDVFHSKYLNVLDWVFGVPLPPYDTTPRKRK 102 AMERDVF SKYLNVLDWVFGVPLPPY+ TPRKRK Sbjct: 290 AMERDVFRSKYLNVLDWVFGVPLPPYEATPRKRK 323 >ref|XP_006364853.1| PREDICTED: uncharacterized protein LOC102579190 [Solanum tuberosum] Length = 491 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 AMERDVFHSKYLNVLDWVFGVPLPPYDTTPRKR 99 AMERDVF SKYLNVLDWVFGVPLPPYDTTPRK+ Sbjct: 453 AMERDVFKSKYLNVLDWVFGVPLPPYDTTPRKK 485 >ref|XP_004237910.1| PREDICTED: uncharacterized protein LOC101254379 [Solanum lycopersicum] Length = 491 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 AMERDVFHSKYLNVLDWVFGVPLPPYDTTPRKR 99 AMERDVF SKYLNVLDWVFGVPLPPYDTTPRK+ Sbjct: 453 AMERDVFKSKYLNVLDWVFGVPLPPYDTTPRKK 485 >gb|EPS64805.1| hypothetical protein M569_09975, partial [Genlisea aurea] Length = 477 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 AMERDVFHSKYLNVLDWVFGVPLPPYDTTPRKR 99 AMER+VF SKYLNVLDWVFGVPLP + TPRK+ Sbjct: 445 AMEREVFRSKYLNVLDWVFGVPLPASEATPRKK 477 >ref|XP_002301052.1| hypothetical protein POPTR_0002s09690g [Populus trichocarpa] gi|222842778|gb|EEE80325.1| hypothetical protein POPTR_0002s09690g [Populus trichocarpa] Length = 486 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 7 ERDVFHSKYLNVLDWVFGVPLPPYDTTPRK 96 ER+VF SKYLNVLDWVFGVP PP DT+PRK Sbjct: 451 EREVFRSKYLNVLDWVFGVPRPPGDTSPRK 480 >ref|XP_002513919.1| conserved hypothetical protein [Ricinus communis] gi|223547005|gb|EEF48502.1| conserved hypothetical protein [Ricinus communis] Length = 588 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1 AMERDVFHSKYLNVLDWVFGVPLPPYDTTPRKRK 102 AMER+VF SKYLNVLDWVFGVP PP D TPR ++ Sbjct: 464 AMEREVFRSKYLNVLDWVFGVP-PPPDETPRAKR 496