BLASTX nr result
ID: Mentha26_contig00029340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00029340 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443524.1| hypothetical protein CICLE_v10022756mg [Citr... 56 6e-06 >ref|XP_006443524.1| hypothetical protein CICLE_v10022756mg [Citrus clementina] gi|557545786|gb|ESR56764.1| hypothetical protein CICLE_v10022756mg [Citrus clementina] Length = 141 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = -2 Query: 360 AARVPKSFKTPVKNQVLFGTFHAQDLTEVENDEKSF---ETLLERRMNIELTDYPGAGAN 190 A R+ KS PV+ Q L AQ+ EV + E+ + +E RM++E TDYPG GAN Sbjct: 75 ATRMAKSDNDPVQVQELL----AQEAMEVSDSEEVLGMEQGYIEGRMDMESTDYPGTGAN 130 Query: 189 PSHDPKTPGK 160 HDPKTPG+ Sbjct: 131 NHHDPKTPGR 140