BLASTX nr result
ID: Mentha26_contig00029163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00029163 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27913.1| hypothetical protein MIMGU_mgv1a009947mg [Mimulus... 59 7e-07 >gb|EYU27913.1| hypothetical protein MIMGU_mgv1a009947mg [Mimulus guttatus] Length = 326 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 370 VVYKSLPLEEAAEGHRIMESSKHIGKIILLV 278 VVYKSLPLEEAAE HRIMESS+HIGKIILLV Sbjct: 295 VVYKSLPLEEAAEAHRIMESSQHIGKIILLV 325