BLASTX nr result
ID: Mentha26_contig00028786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028786 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC66910.1| hypothetical protein L484_000136 [Morus notabilis] 57 4e-06 >gb|EXC66910.1| hypothetical protein L484_000136 [Morus notabilis] Length = 116 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/82 (37%), Positives = 41/82 (50%) Frame = +3 Query: 78 EYPFRVGFRFPLPGLIGQVCGYYNIAPGQLTPNTWRTLIAIEVLAKLVEIPFTYEEVLTV 257 E F +G FP P L + YY++AP QL PN W T++ LA+ EI FT ++ Sbjct: 3 EASFMLGVGFPFPYLASDIFIYYHLAPEQLMPNFWYTILGTTPLAEGTEIEFTNKDFHVC 62 Query: 258 YGLKMVPGDKGRFQLYSKKVKL 323 Y + D GR KK KL Sbjct: 63 YHMMRNMEDSGRCAFVVKKTKL 84