BLASTX nr result
ID: Mentha26_contig00028736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028736 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23118.1| hypothetical protein MIMGU_mgv1a0011952mg, partia... 59 9e-07 >gb|EYU23118.1| hypothetical protein MIMGU_mgv1a0011952mg, partial [Mimulus guttatus] Length = 175 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = -1 Query: 175 MAALSAISLCSHKLFWC-QPKPRQRFISCCVSAPS 74 MAA SAIS+C HKL WC QPKPR+ F+SCCVS PS Sbjct: 1 MAASSAISVCPHKLLWCQQPKPRKNFVSCCVSIPS 35