BLASTX nr result
ID: Mentha26_contig00028673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028673 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004288359.1| PREDICTED: two-pore potassium channel 5-like... 65 1e-08 ref|XP_007051279.1| Ca2+ activated outward rectifying K+ channel... 63 4e-08 gb|EYU46878.1| hypothetical protein MIMGU_mgv1a007372mg [Mimulus... 62 6e-08 ref|XP_006355824.1| PREDICTED: two-pore potassium channel 5-like... 62 8e-08 ref|XP_004240644.1| PREDICTED: two-pore potassium channel 5-like... 62 8e-08 ref|XP_002320260.2| hypothetical protein POPTR_0014s10900g [Popu... 61 2e-07 ref|XP_002515189.1| Calcium-activated outward-rectifying potassi... 61 2e-07 ref|XP_002302805.1| calcium-activated outward-rectifying potassi... 60 2e-07 emb|CBI37064.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_002274039.1| PREDICTED: probable calcium-activated outwar... 60 3e-07 emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] 60 3e-07 ref|XP_007221537.1| hypothetical protein PRUPE_ppa023309mg [Prun... 60 4e-07 ref|XP_006840342.1| hypothetical protein AMTR_s00045p00103250 [A... 59 7e-07 ref|XP_003520770.1| PREDICTED: two-pore potassium channel 5-like... 59 9e-07 gb|EXB44459.1| putative calcium-activated outward-rectifying pot... 58 2e-06 ref|XP_007163240.1| hypothetical protein PHAVU_001G217800g [Phas... 58 2e-06 sp|Q69TN4.1|KCO3_ORYSJ RecName: Full=Two pore potassium channel ... 57 2e-06 ref|XP_002317301.1| calcium-activated outward-rectifying potassi... 57 2e-06 gb|EAZ08520.1| hypothetical protein OsI_30791 [Oryza sativa Indi... 57 2e-06 ref|XP_006660519.1| PREDICTED: LOW QUALITY PROTEIN: two pore pot... 57 3e-06 >ref|XP_004288359.1| PREDICTED: two-pore potassium channel 5-like [Fragaria vesca subsp. vesca] Length = 397 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDI+QICDQFSKLDSN+SGKIT Sbjct: 356 YKLKEMGKIDEKDIMQICDQFSKLDSNHSGKIT 388 >ref|XP_007051279.1| Ca2+ activated outward rectifying K+ channel 5 [Theobroma cacao] gi|508703540|gb|EOX95436.1| Ca2+ activated outward rectifying K+ channel 5 [Theobroma cacao] Length = 388 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDILQIC+QFSKLD NNSGKIT Sbjct: 347 YKLKEMGKIGEKDILQICNQFSKLDPNNSGKIT 379 >gb|EYU46878.1| hypothetical protein MIMGU_mgv1a007372mg [Mimulus guttatus] Length = 409 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKIKE DILQIC+QF+KLD NNSGKIT Sbjct: 368 YKLKEMGKIKETDILQICNQFNKLDPNNSGKIT 400 >ref|XP_006355824.1| PREDICTED: two-pore potassium channel 5-like [Solanum tuberosum] Length = 379 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKD++QIC+QF+KLD NNSGKIT Sbjct: 338 YKLKEMGKISEKDVMQICNQFNKLDENNSGKIT 370 >ref|XP_004240644.1| PREDICTED: two-pore potassium channel 5-like [Solanum lycopersicum] Length = 379 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKD++QIC+QF+KLD NNSGKIT Sbjct: 338 YKLKEMGKINEKDVMQICNQFNKLDENNSGKIT 370 >ref|XP_002320260.2| hypothetical protein POPTR_0014s10900g [Populus trichocarpa] gi|550323953|gb|EEE98575.2| hypothetical protein POPTR_0014s10900g [Populus trichocarpa] Length = 357 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDILQIC+QFSKLD NN GKIT Sbjct: 316 YKLKEMGKIGEKDILQICNQFSKLDPNNLGKIT 348 >ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 390 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDILQIC+QFSKLD NN GKIT Sbjct: 349 YKLKEMGKIGEKDILQICNQFSKLDPNNLGKIT 381 >ref|XP_002302805.1| calcium-activated outward-rectifying potassium channel 5 family protein [Populus trichocarpa] gi|222844531|gb|EEE82078.1| calcium-activated outward-rectifying potassium channel 5 family protein [Populus trichocarpa] Length = 379 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKD+LQIC+QFSKLD NN GKIT Sbjct: 338 YKLKEMGKIGEKDVLQICNQFSKLDPNNLGKIT 370 >emb|CBI37064.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 174 YKLKEMGKIAENDVLQICNQFNKLDPNNSGKIT 206 >ref|XP_002274039.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic [Vitis vinifera] Length = 390 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 349 YKLKEMGKIAENDVLQICNQFNKLDPNNSGKIT 381 >emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] Length = 390 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 349 YKLKEMGKIAENDVLQICNQFNKLDPNNSGKIT 381 >ref|XP_007221537.1| hypothetical protein PRUPE_ppa023309mg [Prunus persica] gi|462418287|gb|EMJ22736.1| hypothetical protein PRUPE_ppa023309mg [Prunus persica] Length = 376 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 +KLKEMGKI EKDILQIC+QFSKLD N+SGKIT Sbjct: 335 HKLKEMGKIGEKDILQICNQFSKLDQNHSGKIT 367 >ref|XP_006840342.1| hypothetical protein AMTR_s00045p00103250 [Amborella trichopoda] gi|548842060|gb|ERN02017.1| hypothetical protein AMTR_s00045p00103250 [Amborella trichopoda] Length = 399 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGK+ EKDILQIC+QF +LD+ NSGKIT Sbjct: 358 YKLKEMGKVAEKDILQICNQFDRLDTENSGKIT 390 >ref|XP_003520770.1| PREDICTED: two-pore potassium channel 5-like [Glycine max] Length = 376 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 +KLKEMGKI+EKD+LQICDQF KLD +N GKIT Sbjct: 335 FKLKEMGKIQEKDVLQICDQFRKLDPSNCGKIT 367 >gb|EXB44459.1| putative calcium-activated outward-rectifying potassium channel 5 [Morus notabilis] Length = 378 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMG+I EKDIL+IC+QF +LD NNSGKIT Sbjct: 327 YKLKEMGRIGEKDILEICNQFCRLDPNNSGKIT 359 >ref|XP_007163240.1| hypothetical protein PHAVU_001G217800g [Phaseolus vulgaris] gi|561036704|gb|ESW35234.1| hypothetical protein PHAVU_001G217800g [Phaseolus vulgaris] Length = 417 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 +KLKEMGKI EKD+LQICDQF KLD +N GKIT Sbjct: 376 FKLKEMGKIHEKDVLQICDQFRKLDPSNCGKIT 408 >sp|Q69TN4.1|KCO3_ORYSJ RecName: Full=Two pore potassium channel c; Short=Two K(+) channel c; AltName: Full=Calcium-activated outward-rectifying potassium channel 3; Short=OsKCO3 gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassium channel KCO1 [Oryza sativa Japonica Group] gi|125605102|gb|EAZ44138.1| hypothetical protein OsJ_28764 [Oryza sativa Japonica Group] Length = 456 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDI+ ICDQF ++DS N GKIT Sbjct: 401 YKLKEMGKISEKDIMMICDQFQRMDSGNCGKIT 433 >ref|XP_002317301.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] gi|222860366|gb|EEE97913.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 428 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDILQIC QF +LD+ N GKIT Sbjct: 387 YKLKEMGKISEKDILQICQQFERLDTGNCGKIT 419 >gb|EAZ08520.1| hypothetical protein OsI_30791 [Oryza sativa Indica Group] Length = 453 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDI+ ICDQF ++DS N GKIT Sbjct: 398 YKLKEMGKISEKDIMMICDQFQRMDSGNCGKIT 430 >ref|XP_006660519.1| PREDICTED: LOW QUALITY PROTEIN: two pore potassium channel c-like [Oryza brachyantha] Length = 452 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 428 YKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 330 YKLKEMGKI EKDI+ ICDQF +LD+ N GKIT Sbjct: 397 YKLKEMGKISEKDIIMICDQFQRLDTGNCGKIT 429