BLASTX nr result
ID: Mentha26_contig00028667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028667 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21887.1| hypothetical protein MIMGU_mgv1a020403mg [Mimulus... 68 1e-09 >gb|EYU21887.1| hypothetical protein MIMGU_mgv1a020403mg [Mimulus guttatus] Length = 395 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = +3 Query: 234 LMAEVELGRQGRKRRRSTWDVAPSAQAEAVERDSEDDEAR--PPPVLRRHVSPPKR 395 ++ E + RQ RKRRR TWDVAPSAQ E ERD+ D+E R P P+LR+HVSPPKR Sbjct: 2 VVEEEDRERQTRKRRRLTWDVAPSAQTEDDERDAGDNEDRAPPAPMLRKHVSPPKR 57