BLASTX nr result
ID: Mentha26_contig00028617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028617 (517 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45012.1| hypothetical protein MIMGU_mgv1a010656mg [Mimulus... 56 4e-06 ref|XP_002511877.1| hypothetical protein RCOM_1615820 [Ricinus c... 56 6e-06 ref|XP_002302591.1| hypothetical protein POPTR_0002s16210g [Popu... 55 8e-06 >gb|EYU45012.1| hypothetical protein MIMGU_mgv1a010656mg [Mimulus guttatus] Length = 306 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 501 DEKMGRLLAPISRLKDVVVGGHRRGSLIIRGSTSSER 391 DE+MGR+L PI R KDV+VGG+RRGSL IRGSTS+ER Sbjct: 271 DERMGRVLGPIYRFKDVIVGGNRRGSL-IRGSTSAER 306 >ref|XP_002511877.1| hypothetical protein RCOM_1615820 [Ricinus communis] gi|223549057|gb|EEF50546.1| hypothetical protein RCOM_1615820 [Ricinus communis] Length = 312 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 513 RCNYDEKMGRLLAPISRLKDVVVGGHRRGSLIIRGSTSSE 394 + N +EK GR+L PISRLKDV+VGGHRRG+ IRG +SSE Sbjct: 273 QANINEKTGRILGPISRLKDVIVGGHRRGT-FIRGGSSSE 311 >ref|XP_002302591.1| hypothetical protein POPTR_0002s16210g [Populus trichocarpa] gi|118485052|gb|ABK94390.1| unknown [Populus trichocarpa] gi|222844317|gb|EEE81864.1| hypothetical protein POPTR_0002s16210g [Populus trichocarpa] Length = 299 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 501 DEKMGRLLAPISRLKDVVVGGHRRGSLIIRGSTSSE 394 +EK GR+L PI+RLKDV+VGGHRRGS IRGSTSS+ Sbjct: 264 NEKSGRILGPITRLKDVIVGGHRRGS-FIRGSTSSD 298