BLASTX nr result
ID: Mentha26_contig00028540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028540 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34066.1| hypothetical protein MIMGU_mgv1a002012mg [Mimulus... 63 5e-08 >gb|EYU34066.1| hypothetical protein MIMGU_mgv1a002012mg [Mimulus guttatus] Length = 726 Score = 63.2 bits (152), Expect = 5e-08 Identities = 34/73 (46%), Positives = 39/73 (53%) Frame = +1 Query: 280 MASMGFLPTGGDSSILVRSANRHRPFISVVAYRPRRVGGVADCNSYGFSSNLAVDLLIRV 459 MASMG PTG D SIL+ SAN RP I ++AYRPR ++ Sbjct: 1 MASMGSFPTGLDGSILLHSANHQRPVIPILAYRPR-----------------------KL 37 Query: 460 SLCNGCGGRRRRW 498 SLCNGC G RRRW Sbjct: 38 SLCNGCSGGRRRW 50