BLASTX nr result
ID: Mentha26_contig00028445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028445 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Mimulus... 69 5e-10 ref|XP_007150863.1| hypothetical protein PHAVU_004G000600g [Phas... 66 6e-09 ref|XP_004297695.1| PREDICTED: katanin p80 WD40 repeat-containin... 65 8e-09 ref|XP_006360856.1| PREDICTED: katanin p80 WD40 repeat-containin... 65 1e-08 ref|XP_004236878.1| PREDICTED: katanin p80 WD40 repeat-containin... 65 1e-08 ref|XP_006468674.1| PREDICTED: katanin p80 WD40 repeat-containin... 65 1e-08 ref|XP_006468672.1| PREDICTED: katanin p80 WD40 repeat-containin... 65 1e-08 ref|XP_004489185.1| PREDICTED: katanin p80 WD40 repeat-containin... 64 2e-08 ref|XP_006603797.1| PREDICTED: katanin p80 WD40 repeat-containin... 64 3e-08 ref|XP_006448506.1| hypothetical protein CICLE_v10014294mg [Citr... 63 4e-08 ref|XP_003525689.2| PREDICTED: katanin p80 WD40 repeat-containin... 62 8e-08 ref|XP_007043149.1| Transducin/WD40 repeat-like superfamily prot... 62 8e-08 ref|XP_004231535.1| PREDICTED: katanin p80 WD40 repeat-containin... 62 1e-07 ref|XP_006361541.1| PREDICTED: katanin p80 WD40 repeat-containin... 60 2e-07 ref|XP_007221941.1| hypothetical protein PRUPE_ppa001553mg [Prun... 60 2e-07 ref|XP_002311885.1| hypothetical protein POPTR_0008s00290g [Popu... 60 4e-07 ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containin... 59 7e-07 emb|CBI35338.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_006468673.1| PREDICTED: katanin p80 WD40 repeat-containin... 58 1e-06 ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containin... 58 2e-06 >gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Mimulus guttatus] Length = 164 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLCY ELEKVK SLP LSR+GGSIAKSAHELNLALQE+S Sbjct: 126 NLCYTELEKVKRSLPHLSRKGGSIAKSAHELNLALQEVS 164 >ref|XP_007150863.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris] gi|593700893|ref|XP_007150864.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris] gi|561024172|gb|ESW22857.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris] gi|561024173|gb|ESW22858.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris] Length = 759 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC+ ELEKVK LP+LSRRGGSIAKSAHELNLALQ++S Sbjct: 721 NLCFPELEKVKRFLPSLSRRGGSIAKSAHELNLALQDVS 759 >ref|XP_004297695.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Fragaria vesca subsp. vesca] Length = 795 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC++ELEKVK LPAL+RRGGSIAKSA ELNLALQE+S Sbjct: 757 NLCFMELEKVKGCLPALTRRGGSIAKSAQELNLALQEVS 795 >ref|XP_006360856.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Solanum tuberosum] Length = 811 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC++ELEKVK LPALSRRGGSIAK+A ELNLAL E+S Sbjct: 773 NLCFIELEKVKSCLPALSRRGGSIAKTAQELNLALHEVS 811 >ref|XP_004236878.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Solanum lycopersicum] Length = 810 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC++ELEKVK LPALSRRGGSIAK+A ELNLAL E+S Sbjct: 772 NLCFIELEKVKSCLPALSRRGGSIAKTAQELNLALHEVS 810 >ref|XP_006468674.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Citrus sinensis] Length = 811 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 N C++ELEKVKC LP L RRGGS+AKSA ELNLALQ++S Sbjct: 773 NRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS 811 >ref|XP_006468672.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Citrus sinensis] Length = 819 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 N C++ELEKVKC LP L RRGGS+AKSA ELNLALQ++S Sbjct: 781 NRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS 819 >ref|XP_004489185.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cicer arietinum] Length = 747 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC+VELEKVK LP+L RRGGSIAK AHELNLALQ++S Sbjct: 709 NLCFVELEKVKRFLPSLMRRGGSIAKFAHELNLALQDVS 747 >ref|XP_006603797.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Glycine max] Length = 759 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC+ ELEKVK LP+LSRRGGSIAKSA ELNLALQ++S Sbjct: 721 NLCFTELEKVKRFLPSLSRRGGSIAKSAQELNLALQDVS 759 >ref|XP_006448506.1| hypothetical protein CICLE_v10014294mg [Citrus clementina] gi|557551117|gb|ESR61746.1| hypothetical protein CICLE_v10014294mg [Citrus clementina] Length = 818 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEI 114 N C++ELEKVKC LP L RRGGS+AKSA ELNLALQ++ Sbjct: 781 NRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDV 818 >ref|XP_003525689.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Glycine max] Length = 759 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEI 114 NLC+ ELEKVK LP+LSRRGGSIAKSA ELNLALQ++ Sbjct: 721 NLCFTELEKVKRFLPSLSRRGGSIAKSAQELNLALQDV 758 >ref|XP_007043149.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508707084|gb|EOX98980.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 1199 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEI 114 NLC++ELEKVK LP L+RRGGS+AKSA ELNLA+QE+ Sbjct: 817 NLCFIELEKVKRCLPTLTRRGGSVAKSAQELNLAIQEV 854 >ref|XP_004231535.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Solanum lycopersicum] Length = 798 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC+VELEKVK LPAL+RRGGSIAKSA EL+LALQ+ S Sbjct: 760 NLCFVELEKVKNWLPALTRRGGSIAKSAQELSLALQDFS 798 >ref|XP_006361541.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Solanum tuberosum] Length = 798 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 NLC+VELEKVK LP+L+RRGGSIAKSA EL+LALQ+ S Sbjct: 760 NLCFVELEKVKNWLPSLTRRGGSIAKSAQELSLALQDFS 798 >ref|XP_007221941.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica] gi|462418877|gb|EMJ23140.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica] Length = 803 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 N C++ELEKVK L AL+RRGGSIAKSA ELNLALQE+S Sbjct: 765 NNCFMELEKVKTCLSALTRRGGSIAKSAQELNLALQEVS 803 >ref|XP_002311885.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa] gi|222851705|gb|EEE89252.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa] Length = 802 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 N+C+VELEKVK L L+R+GGS+AK AHELNLALQE+S Sbjct: 764 NICFVELEKVKRCLLTLTRKGGSVAKFAHELNLALQEVS 802 >ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Vitis vinifera] Length = 800 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEI 114 NLC++ELEK+K LPAL+RRGGS+AK A ELNLAL E+ Sbjct: 762 NLCFIELEKIKHCLPALTRRGGSVAKLAQELNLALLEV 799 >emb|CBI35338.3| unnamed protein product [Vitis vinifera] Length = 989 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEI 114 NLC++ELEK+K LPAL+RRGGS+AK A ELNLAL E+ Sbjct: 951 NLCFIELEKIKHCLPALTRRGGSVAKLAQELNLALLEV 988 >ref|XP_006468673.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Citrus sinensis] Length = 818 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQEIS 117 N C++ELEKVKC LP L R GGS+AKSA ELNLALQ++S Sbjct: 781 NRCFIELEKVKCCLPTLMR-GGSVAKSAQELNLALQDVS 818 >ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] gi|449524677|ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Length = 795 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 NLCYVELEKVKCSLPALSRRGGSIAKSAHELNLALQE 111 NLC++ELEKVK LPAL R+ GS+AKSA ELNLALQE Sbjct: 757 NLCFIELEKVKRCLPALIRKRGSVAKSAQELNLALQE 793