BLASTX nr result
ID: Mentha26_contig00028006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00028006 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28019.1| Cell division protein FtsY-like protein [Morus no... 94 3e-17 ref|XP_002511808.1| cell division protein ftsy, putative [Ricinu... 94 3e-17 ref|XP_007051904.1| Signal recognition particle receptor protein... 91 1e-16 ref|XP_007051903.1| Signal recognition particle receptor protein... 91 1e-16 ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citr... 91 2e-16 ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolo... 91 2e-16 ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolo... 91 2e-16 ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago ... 91 2e-16 ref|XP_002320775.1| signal recognition particle receptor family ... 91 2e-16 gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlise... 91 2e-16 gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] 90 3e-16 gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum... 90 3e-16 dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgar... 90 3e-16 ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phas... 90 4e-16 ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolo... 90 4e-16 ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolo... 90 4e-16 ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [A... 89 5e-16 ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolo... 89 5e-16 ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prun... 89 6e-16 ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prun... 89 6e-16 >gb|EXC28019.1| Cell division protein FtsY-like protein [Morus notabilis] Length = 371 Score = 93.6 bits (231), Expect = 3e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP Sbjct: 327 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 371 >ref|XP_002511808.1| cell division protein ftsy, putative [Ricinus communis] gi|223548988|gb|EEF50477.1| cell division protein ftsy, putative [Ricinus communis] Length = 362 Score = 93.6 bits (231), Expect = 3e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP Sbjct: 318 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 362 >ref|XP_007051904.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] gi|508704165|gb|EOX96061.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] Length = 365 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 GSARGGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 321 GSARGGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 365 >ref|XP_007051903.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] gi|508704164|gb|EOX96060.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] Length = 445 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 GSARGGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 401 GSARGGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 445 >ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|567905284|ref|XP_006445130.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|568875898|ref|XP_006491027.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Citrus sinensis] gi|557547391|gb|ESR58369.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|557547392|gb|ESR58370.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] Length = 372 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 328 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cicer arietinum] Length = 365 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 321 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Glycine max] gi|571443916|ref|XP_006576355.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Glycine max] Length = 372 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 328 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago truncatula] gi|355521650|gb|AET02104.1| Signal recognition 54 kDa protein [Medicago truncatula] Length = 402 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 358 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >ref|XP_002320775.1| signal recognition particle receptor family protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| signal recognition particle receptor family protein [Populus trichocarpa] Length = 365 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 321 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlisea aurea] Length = 330 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFD +AFVNAIFP Sbjct: 286 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDPQAFVNAIFP 330 >gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] Length = 370 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 G+ARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 326 GTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 370 >gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum urartu] Length = 336 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 G+ARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 292 GTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 336 >dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532852|dbj|BAJ89271.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 G+ARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 311 GTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 355 >ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] gi|561008046|gb|ESW06995.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] Length = 371 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDA+AFVNAIF Sbjct: 327 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDADAFVNAIF 370 >ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolog [Brachypodium distachyon] Length = 360 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 137 G+ARGGCVVSVVDELGIPVKFVG+GEGVEDLQPFDAEAFV AIFP Sbjct: 316 GTARGGCVVSVVDELGIPVKFVGIGEGVEDLQPFDAEAFVEAIFP 360 >ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Glycine max] Length = 372 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE+FVNAIF Sbjct: 328 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371 >ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] gi|548861955|gb|ERN19320.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] Length = 402 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCV SVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 358 GSARGGCVASVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolog, chloroplastic [Vitis vinifera] gi|296089055|emb|CBI38758.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF Sbjct: 323 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEVFVNAIF 366 >ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] gi|462416829|gb|EMJ21566.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] Length = 333 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVV+ELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 289 GSARGGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 332 >ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] gi|462414630|gb|EMJ19367.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] Length = 365 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +3 Query: 3 GSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 134 GSARGGCVVSVV+ELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 321 GSARGGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364