BLASTX nr result
ID: Mentha26_contig00027802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00027802 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33827.1| hypothetical protein MIMGU_mgv1a009772mg [Mimulus... 62 8e-08 >gb|EYU33827.1| hypothetical protein MIMGU_mgv1a009772mg [Mimulus guttatus] Length = 332 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 509 EPVKQGSVHVTLPEDADEQVIAQTLESELKKFKDLN 402 EP+KQGSVHVTLPEDADE+ IA+ LESEL+KFKDL+ Sbjct: 281 EPLKQGSVHVTLPEDADEEDIAKALESELEKFKDLD 316