BLASTX nr result
ID: Mentha26_contig00027723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00027723 (642 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30384.3| unnamed protein product [Vitis vinifera] 69 2e-09 ref|XP_002274939.1| PREDICTED: uncharacterized protein LOC100242... 69 2e-09 ref|XP_006430071.1| hypothetical protein CICLE_v10011038mg [Citr... 63 7e-08 ref|XP_006430070.1| hypothetical protein CICLE_v10011038mg [Citr... 63 7e-08 ref|XP_006481592.1| PREDICTED: uncharacterized protein LOC102624... 60 6e-07 ref|XP_002532548.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >emb|CBI30384.3| unnamed protein product [Vitis vinifera] Length = 701 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/59 (50%), Positives = 49/59 (83%) Frame = -1 Query: 642 LLMYQDTKVRQILSSCKIEMETVLQNILNLQTSEGPNMRLEERHKIERAYNQLRAITNS 466 +LM++D K+++ILSSCK E++ +LQN+L LQ S+G NM +EERH I+ A+++L+ IT++ Sbjct: 635 ILMHKDVKIQRILSSCKSEIDHILQNMLLLQASKGMNMSIEERHNIQCAFDRLKCITST 693 >ref|XP_002274939.1| PREDICTED: uncharacterized protein LOC100242503 [Vitis vinifera] Length = 891 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/59 (50%), Positives = 49/59 (83%) Frame = -1 Query: 642 LLMYQDTKVRQILSSCKIEMETVLQNILNLQTSEGPNMRLEERHKIERAYNQLRAITNS 466 +LM++D K+++ILSSCK E++ +LQN+L LQ S+G NM +EERH I+ A+++L+ IT++ Sbjct: 825 ILMHKDVKIQRILSSCKSEIDHILQNMLLLQASKGMNMSIEERHNIQCAFDRLKCITST 883 >ref|XP_006430071.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] gi|557532128|gb|ESR43311.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] Length = 753 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/57 (54%), Positives = 45/57 (78%) Frame = -1 Query: 642 LLMYQDTKVRQILSSCKIEMETVLQNILNLQTSEGPNMRLEERHKIERAYNQLRAIT 472 LLM++DTKVR+I+SS K E+ +LQ I +LQ+S+ NM EERHKI+ AY++L+ +T Sbjct: 687 LLMHKDTKVRKIISSFKEEVVHILQIIHSLQSSDSENMNFEERHKIQCAYSRLKLVT 743 >ref|XP_006430070.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] gi|557532127|gb|ESR43310.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] Length = 890 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/57 (54%), Positives = 45/57 (78%) Frame = -1 Query: 642 LLMYQDTKVRQILSSCKIEMETVLQNILNLQTSEGPNMRLEERHKIERAYNQLRAIT 472 LLM++DTKVR+I+SS K E+ +LQ I +LQ+S+ NM EERHKI+ AY++L+ +T Sbjct: 824 LLMHKDTKVRKIISSFKEEVVHILQIIHSLQSSDSENMNFEERHKIQCAYSRLKLVT 880 >ref|XP_006481592.1| PREDICTED: uncharacterized protein LOC102624133 isoform X1 [Citrus sinensis] Length = 890 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -1 Query: 642 LLMYQDTKVRQILSSCKIEMETVLQNILNLQTSEGPNMRLEERHKIERAYNQLRAI 475 LLM++DTKVR+I+SS K E+ +LQ I +LQ+S+ NM +ERHKI+ AY++L+ + Sbjct: 824 LLMHKDTKVRKIISSFKEEVVDILQIIHSLQSSDSENMNFKERHKIQCAYSRLKLV 879 >ref|XP_002532548.1| conserved hypothetical protein [Ricinus communis] gi|223527737|gb|EEF29842.1| conserved hypothetical protein [Ricinus communis] Length = 856 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/59 (44%), Positives = 45/59 (76%) Frame = -1 Query: 642 LLMYQDTKVRQILSSCKIEMETVLQNILNLQTSEGPNMRLEERHKIERAYNQLRAITNS 466 LLM++D+K+ Q+LS + E++ + QNI ++Q+S G ++ + ERHKI+ A +QL+ IT+S Sbjct: 790 LLMHKDSKIEQLLSLLRAEVDLISQNICSVQSSAGSSLSVGERHKIQCALDQLKTITSS 848