BLASTX nr result
ID: Mentha26_contig00027722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00027722 (624 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30384.3| unnamed protein product [Vitis vinifera] 76 7e-12 ref|XP_002274939.1| PREDICTED: uncharacterized protein LOC100242... 76 7e-12 ref|XP_006481592.1| PREDICTED: uncharacterized protein LOC102624... 69 1e-09 ref|XP_006430071.1| hypothetical protein CICLE_v10011038mg [Citr... 69 1e-09 ref|XP_006430070.1| hypothetical protein CICLE_v10011038mg [Citr... 69 1e-09 ref|XP_002532548.1| conserved hypothetical protein [Ricinus comm... 65 2e-08 gb|EYU18123.1| hypothetical protein MIMGU_mgv1a001441mg [Mimulus... 64 5e-08 gb|EXB38189.1| hypothetical protein L484_004094 [Morus notabilis] 62 1e-07 ref|XP_004228907.1| PREDICTED: uncharacterized protein LOC101261... 62 1e-07 ref|XP_007027963.1| ARM repeat superfamily protein, putative iso... 62 1e-07 ref|XP_006348473.1| PREDICTED: uncharacterized protein LOC102580... 61 2e-07 ref|XP_007027964.1| ARM repeat superfamily protein, putative iso... 61 3e-07 ref|XP_002874334.1| binding protein [Arabidopsis lyrata subsp. l... 60 4e-07 ref|XP_004303376.1| PREDICTED: uncharacterized protein LOC101296... 60 7e-07 gb|EXC21216.1| hypothetical protein L484_002226 [Morus notabilis] 59 2e-06 ref|NP_198053.1| uncharacterized protein [Arabidopsis thaliana] ... 58 2e-06 ref|XP_002871213.1| binding protein [Arabidopsis lyrata subsp. l... 58 2e-06 dbj|BAB08957.1| unnamed protein product [Arabidopsis thaliana] 58 3e-06 ref|XP_007203976.1| hypothetical protein PRUPE_ppa025120mg [Prun... 58 3e-06 ref|NP_196253.2| Rix1 complex component domain-containing protei... 58 3e-06 >emb|CBI30384.3| unnamed protein product [Vitis vinifera] Length = 701 Score = 76.3 bits (186), Expect = 7e-12 Identities = 35/72 (48%), Positives = 55/72 (76%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D + I I +L+LM+KD+K+++ILSSCK E++ ILQN+L LQ S+G NM +EERH I+ Sbjct: 622 DHTNRIRAIVEILILMHKDVKIQRILSSCKSEIDHILQNMLLLQASKGMNMSIEERHNIQ 681 Query: 182 RAYNQLRAIANS 217 A+++L+ I ++ Sbjct: 682 CAFDRLKCITST 693 >ref|XP_002274939.1| PREDICTED: uncharacterized protein LOC100242503 [Vitis vinifera] Length = 891 Score = 76.3 bits (186), Expect = 7e-12 Identities = 35/72 (48%), Positives = 55/72 (76%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D + I I +L+LM+KD+K+++ILSSCK E++ ILQN+L LQ S+G NM +EERH I+ Sbjct: 812 DHTNRIRAIVEILILMHKDVKIQRILSSCKSEIDHILQNMLLLQASKGMNMSIEERHNIQ 871 Query: 182 RAYNQLRAIANS 217 A+++L+ I ++ Sbjct: 872 CAFDRLKCITST 883 >ref|XP_006481592.1| PREDICTED: uncharacterized protein LOC102624133 isoform X1 [Citrus sinensis] Length = 890 Score = 68.9 bits (167), Expect = 1e-09 Identities = 36/70 (51%), Positives = 50/70 (71%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S I + S LLLM+KD KVR+I+SS K E+ ILQ I +LQ+S+ NM +ERHKI+ Sbjct: 811 DNSNQINAVVSALLLMHKDTKVRKIISSFKEEVVDILQIIHSLQSSDSENMNFKERHKIQ 870 Query: 182 RAYNQLRAIA 211 AY++L+ +A Sbjct: 871 CAYSRLKLVA 880 >ref|XP_006430071.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] gi|557532128|gb|ESR43311.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] Length = 753 Score = 68.6 bits (166), Expect = 1e-09 Identities = 36/69 (52%), Positives = 49/69 (71%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S I + S LLLM+KD KVR+I+SS K E+ ILQ I +LQ+S+ NM EERHKI+ Sbjct: 674 DNSNQINAVVSALLLMHKDTKVRKIISSFKEEVVHILQIIHSLQSSDSENMNFEERHKIQ 733 Query: 182 RAYNQLRAI 208 AY++L+ + Sbjct: 734 CAYSRLKLV 742 >ref|XP_006430070.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] gi|557532127|gb|ESR43310.1| hypothetical protein CICLE_v10011038mg [Citrus clementina] Length = 890 Score = 68.6 bits (166), Expect = 1e-09 Identities = 36/69 (52%), Positives = 49/69 (71%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S I + S LLLM+KD KVR+I+SS K E+ ILQ I +LQ+S+ NM EERHKI+ Sbjct: 811 DNSNQINAVVSALLLMHKDTKVRKIISSFKEEVVHILQIIHSLQSSDSENMNFEERHKIQ 870 Query: 182 RAYNQLRAI 208 AY++L+ + Sbjct: 871 CAYSRLKLV 879 >ref|XP_002532548.1| conserved hypothetical protein [Ricinus communis] gi|223527737|gb|EEF29842.1| conserved hypothetical protein [Ricinus communis] Length = 856 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/70 (45%), Positives = 50/70 (71%) Frame = +2 Query: 8 STTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERA 187 S+ I + SVLLLM+KD K+ Q+LS + E++ I QNI ++Q+S G ++ + ERHKI+ A Sbjct: 779 SSRITAVVSVLLLMHKDSKIEQLLSLLRAEVDLISQNICSVQSSAGSSLSVGERHKIQCA 838 Query: 188 YNQLRAIANS 217 +QL+ I +S Sbjct: 839 LDQLKTITSS 848 >gb|EYU18123.1| hypothetical protein MIMGU_mgv1a001441mg [Mimulus guttatus] Length = 819 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNL 130 DRS TIC I SVL M KD+K+RQIL SCKIE ET+LQN+LNL Sbjct: 775 DRSITICAIGSVLFHMNKDVKIRQILLSCKIESETMLQNLLNL 817 >gb|EXB38189.1| hypothetical protein L484_004094 [Morus notabilis] Length = 920 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/72 (44%), Positives = 50/72 (69%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S+TI SVLL M+KD+K+R+I+SS K ++ I Q I+ LQ+SE + LEERHK++ Sbjct: 841 DCSSTIDAAVSVLLSMHKDVKIRRIISSFKEDIHDIFQKIVCLQSSEEIRLTLEERHKVQ 900 Query: 182 RAYNQLRAIANS 217 + ++L + +S Sbjct: 901 CSVDKLTVVTSS 912 >ref|XP_004228907.1| PREDICTED: uncharacterized protein LOC101261149 [Solanum lycopersicum] Length = 927 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/72 (43%), Positives = 49/72 (68%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S+ I + SVLLL+ DIK++++L SCK ++ IL+++ L++SE M +EERHKI Sbjct: 852 DHSSRILSVVSVLLLVLGDIKMQKLLLSCKTQIRNILESMHRLESSEDITMTIEERHKIR 911 Query: 182 RAYNQLRAIANS 217 AY+ L A ++ Sbjct: 912 SAYDILTAAVST 923 >ref|XP_007027963.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508716568|gb|EOY08465.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 959 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/66 (45%), Positives = 52/66 (78%) Frame = +2 Query: 32 SVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRAIA 211 S+LLL+YKD+KV++I+S + E+ +I+Q+I +LQ+SE NM +EERHK + ++ +L+ +A Sbjct: 883 SLLLLIYKDVKVQKIMSLFRTEIGSIMQSIASLQSSE-VNMTIEERHKFQCSFERLKIVA 941 Query: 212 NSEVVI 229 +S V+ Sbjct: 942 SSSPVV 947 >ref|XP_006348473.1| PREDICTED: uncharacterized protein LOC102580073 [Solanum tuberosum] Length = 884 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/72 (43%), Positives = 48/72 (66%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S+ I + SVLLL+ DIK++++L SCK + IL+++ L++SE M +EERHKI Sbjct: 809 DHSSRILSVVSVLLLVLGDIKMQKLLLSCKTAIRNILESMHTLESSEDITMTIEERHKIR 868 Query: 182 RAYNQLRAIANS 217 AY+ L A ++ Sbjct: 869 SAYDILTAAVST 880 >ref|XP_007027964.1| ARM repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|590632870|ref|XP_007027965.1| ARM repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508716569|gb|EOY08466.1| ARM repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508716570|gb|EOY08467.1| ARM repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 874 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/65 (46%), Positives = 51/65 (78%) Frame = +2 Query: 32 SVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRAIA 211 S+LLL+YKD+KV++I+S + E+ +I+Q+I +LQ+SE NM +EERHK + ++ +L+ +A Sbjct: 810 SLLLLIYKDVKVQKIMSLFRTEIGSIMQSIASLQSSE-VNMTIEERHKFQCSFERLKIVA 868 Query: 212 NSEVV 226 +S V Sbjct: 869 SSSPV 873 >ref|XP_002874334.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297320171|gb|EFH50593.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 861 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/64 (45%), Positives = 46/64 (71%) Frame = +2 Query: 26 IASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRA 205 I SV+LLM+ D+KVR+I+SS K E++ ILQN++ LQ S ++ +E +H ++ A +LR Sbjct: 795 IVSVILLMHNDVKVRKIISSSKSEIDLILQNVITLQPSRSTSLTVEGKHMMKIAGERLRI 854 Query: 206 IANS 217 +NS Sbjct: 855 ASNS 858 >ref|XP_004303376.1| PREDICTED: uncharacterized protein LOC101296122 [Fragaria vesca subsp. vesca] Length = 882 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/75 (37%), Positives = 57/75 (76%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S+ + I SVLLL++ D K+ +I+SS K E++ ILQ+I+++Q+SE +M ++E+H+++ Sbjct: 808 DISSRVEVIVSVLLLLHNDEKIGRIMSSFKAEIDYILQSIISIQSSEEISMTIQEKHQVK 867 Query: 182 RAYNQLRAIANSEVV 226 A+++L+ + +++ V Sbjct: 868 CAHDRLKNVTSAQSV 882 >gb|EXC21216.1| hypothetical protein L484_002226 [Morus notabilis] Length = 1018 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/72 (40%), Positives = 50/72 (69%) Frame = +2 Query: 2 DRSTTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIE 181 D S+TI SVLL M+KD+K+ +I+SS K ++ I + I+ LQ+SE + LEE+HK++ Sbjct: 939 DCSSTIDAAVSVLLSMHKDVKILRIISSFKEDVHDIFRKIVCLQSSEEIRLNLEEKHKVQ 998 Query: 182 RAYNQLRAIANS 217 + ++L+ + +S Sbjct: 999 CSVDKLKVVTSS 1010 >ref|NP_198053.1| uncharacterized protein [Arabidopsis thaliana] gi|332006257|gb|AED93640.1| uncharacterized protein AT5G27010 [Arabidopsis thaliana] Length = 863 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/64 (43%), Positives = 45/64 (70%) Frame = +2 Query: 26 IASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRA 205 I SV+LLM+ D+KVR+I+SS K E++ ILQN+ LQ+S ++ +E +H ++ A +L Sbjct: 797 IVSVILLMHNDVKVRKIISSSKSEIDLILQNVYTLQSSRSTSLTVEGKHMMKIAAERLSI 856 Query: 206 IANS 217 +NS Sbjct: 857 ASNS 860 >ref|XP_002871213.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297317050|gb|EFH47472.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 890 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/64 (43%), Positives = 46/64 (71%) Frame = +2 Query: 26 IASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRA 205 I SV+LLM+ D+KVR+I+SS K E++ ILQN++ LQ+S ++ +E +H ++ A +LR Sbjct: 824 IISVILLMHNDVKVRKIISSFKSEIDLILQNVITLQSSRSTSLTVEGKHMMKIAGERLRI 883 Query: 206 IANS 217 + S Sbjct: 884 ASTS 887 >dbj|BAB08957.1| unnamed protein product [Arabidopsis thaliana] Length = 890 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/64 (43%), Positives = 46/64 (71%) Frame = +2 Query: 26 IASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRA 205 I SV+LLM+ D+KVR+I+SS K E++ ILQN++ LQ+S ++ +E +H ++ A +LR Sbjct: 824 IISVILLMHNDVKVRKIISSFKPEIDLILQNVITLQSSRSTSLTVEGKHMMKIAGERLRI 883 Query: 206 IANS 217 + S Sbjct: 884 ASKS 887 >ref|XP_007203976.1| hypothetical protein PRUPE_ppa025120mg [Prunus persica] gi|462399507|gb|EMJ05175.1| hypothetical protein PRUPE_ppa025120mg [Prunus persica] Length = 884 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/67 (43%), Positives = 48/67 (71%) Frame = +2 Query: 8 STTICRIASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERA 187 S+ + + SVL LM+KD K+ QI+SS K E++ IL++I+ LQ+S+ +M +EERH ++ A Sbjct: 811 SSRVDAVVSVLQLMHKDDKIWQIISSFKAEIDCILESIIVLQSSKEISMTIEERHMVQCA 870 Query: 188 YNQLRAI 208 +LR + Sbjct: 871 LGRLRTL 877 >ref|NP_196253.2| Rix1 complex component domain-containing protein [Arabidopsis thaliana] gi|332003622|gb|AED91005.1| Rix1 complex component domain-containing protein [Arabidopsis thaliana] Length = 877 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/64 (43%), Positives = 46/64 (71%) Frame = +2 Query: 26 IASVLLLMYKDIKVRQILSSCKIEMETILQNILNLQTSEGPNMRLEERHKIERAYNQLRA 205 I SV+LLM+ D+KVR+I+SS K E++ ILQN++ LQ+S ++ +E +H ++ A +LR Sbjct: 811 IISVILLMHNDVKVRKIISSFKPEIDLILQNVITLQSSRSTSLTVEGKHMMKIAGERLRI 870 Query: 206 IANS 217 + S Sbjct: 871 ASKS 874