BLASTX nr result
ID: Mentha26_contig00027070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00027070 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24335.1| hypothetical protein MIMGU_mgv1a004902mg [Mimulus... 65 1e-08 gb|EYU24348.1| hypothetical protein MIMGU_mgv1a0190601mg, partia... 64 3e-08 ref|XP_004253265.1| PREDICTED: uncharacterized protein LOC101263... 60 4e-07 ref|XP_002263508.2| PREDICTED: uncharacterized protein LOC100240... 59 5e-07 emb|CBI29366.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_006359028.1| PREDICTED: uncharacterized protein LOC102580... 58 1e-06 ref|XP_007019649.1| Nucleic acid-binding proteins superfamily is... 57 3e-06 ref|XP_007019648.1| Nucleic acid-binding proteins superfamily is... 57 3e-06 ref|XP_007019647.1| Nucleic acid-binding proteins superfamily is... 57 3e-06 >gb|EYU24335.1| hypothetical protein MIMGU_mgv1a004902mg [Mimulus guttatus] Length = 505 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDR 90 RKLEPLPT GLPFEDEEK Y+NWKWFKF+R Sbjct: 472 RKLEPLPTNGLPFEDEEKLYSNWKWFKFER 501 >gb|EYU24348.1| hypothetical protein MIMGU_mgv1a0190601mg, partial [Mimulus guttatus] Length = 367 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDR 90 +KLEPLPT GLPFEDEEK Y+NWKWFKF+R Sbjct: 334 KKLEPLPTNGLPFEDEEKLYSNWKWFKFER 363 >ref|XP_004253265.1| PREDICTED: uncharacterized protein LOC101263198 [Solanum lycopersicum] Length = 513 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDKLN 105 +K EPLPT+ LPFEDEE YANWKWFKFDR D +N Sbjct: 478 KKPEPLPTDRLPFEDEENMYANWKWFKFDR-DNVN 511 >ref|XP_002263508.2| PREDICTED: uncharacterized protein LOC100240915 [Vitis vinifera] Length = 513 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDKLN 105 RKLEPLPT+ LPF DE YANW+WFKF+R D N Sbjct: 479 RKLEPLPTDALPFHDEASLYANWRWFKFERDDGPN 513 >emb|CBI29366.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDKLN 105 RKLEPLPT+ LPF DE YANW+WFKF+R D N Sbjct: 401 RKLEPLPTDALPFHDEASLYANWRWFKFERDDGPN 435 >ref|XP_006359028.1| PREDICTED: uncharacterized protein LOC102580008 [Solanum tuberosum] Length = 513 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDKLN 105 +K EPLPT+ LPFEDEE YANWKWFKF+R D +N Sbjct: 478 KKPEPLPTDRLPFEDEENMYANWKWFKFER-DNVN 511 >ref|XP_007019649.1| Nucleic acid-binding proteins superfamily isoform 3, partial [Theobroma cacao] gi|508724977|gb|EOY16874.1| Nucleic acid-binding proteins superfamily isoform 3, partial [Theobroma cacao] Length = 511 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDK 99 R +EPLPT+ LPF++EE Y NWKWFKF+R D+ Sbjct: 477 RNVEPLPTDALPFDNEESLYVNWKWFKFEREDE 509 >ref|XP_007019648.1| Nucleic acid-binding proteins superfamily isoform 2 [Theobroma cacao] gi|508724976|gb|EOY16873.1| Nucleic acid-binding proteins superfamily isoform 2 [Theobroma cacao] Length = 521 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDK 99 R +EPLPT+ LPF++EE Y NWKWFKF+R D+ Sbjct: 487 RNVEPLPTDALPFDNEESLYVNWKWFKFEREDE 519 >ref|XP_007019647.1| Nucleic acid-binding proteins superfamily isoform 1 [Theobroma cacao] gi|508724975|gb|EOY16872.1| Nucleic acid-binding proteins superfamily isoform 1 [Theobroma cacao] Length = 512 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +1 Query: 1 RKLEPLPTEGLPFEDEEKFYANWKWFKFDRGDK 99 R +EPLPT+ LPF++EE Y NWKWFKF+R D+ Sbjct: 478 RNVEPLPTDALPFDNEESLYVNWKWFKFEREDE 510