BLASTX nr result
ID: Mentha26_contig00026985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026985 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518141.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 ref|XP_002303882.2| hypothetical protein POPTR_0003s22330g [Popu... 55 1e-05 >ref|XP_002518141.1| conserved hypothetical protein [Ricinus communis] gi|223542737|gb|EEF44274.1| conserved hypothetical protein [Ricinus communis] Length = 422 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +1 Query: 58 EERDCVIVRIEYKVHNLSTFTSSKPIIDYVDHNLKQSNEKDFEPQIVSIGPIHHGKDHVK 237 EE DCV + I K+ +LS +S + I V + ++ NEK + P+I++IGP H GKDH+K Sbjct: 4 EELDCVAISINEKLGSLSPLSSDRCIFK-VPNQVRVVNEKAYAPEIIAIGPYHRGKDHLK 62 Query: 238 TMEQH 252 ME+H Sbjct: 63 AMEEH 67 >ref|XP_002303882.2| hypothetical protein POPTR_0003s22330g [Populus trichocarpa] gi|550343777|gb|EEE78861.2| hypothetical protein POPTR_0003s22330g [Populus trichocarpa] Length = 434 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +1 Query: 85 IEYKVHNLSTFTSSKPIIDYVDHNLKQSNEKDFEPQIVSIGPIHHGKDHVKTMEQH 252 +E K+ +L F+S+ I V L++ NEK + PQ++SIGP HHGK +K ME+H Sbjct: 14 VEIKLRSLRPFSSNCSIFR-VPKRLRELNEKSYTPQVISIGPFHHGKQELKKMEEH 68