BLASTX nr result
ID: Mentha26_contig00026983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026983 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30138.1| hypothetical protein MIMGU_mgv1a003601mg [Mimulus... 75 1e-11 ref|XP_007225140.1| hypothetical protein PRUPE_ppa002493mg [Prun... 62 1e-07 ref|XP_006448147.1| hypothetical protein CICLE_v10014527mg [Citr... 61 1e-07 ref|XP_007045291.1| Two-component response regulator ARR14 isofo... 61 2e-07 ref|XP_007045295.1| Uncharacterized protein TCM_011069 [Theobrom... 60 2e-07 ref|XP_002533196.1| two-component sensor histidine kinase bacter... 60 2e-07 gb|EXB32324.1| Two-component response regulator [Morus notabilis] 60 3e-07 ref|XP_006469262.1| PREDICTED: two-component response regulator ... 60 4e-07 ref|XP_006469261.1| PREDICTED: two-component response regulator ... 60 4e-07 ref|XP_006469260.1| PREDICTED: two-component response regulator ... 60 4e-07 ref|XP_006469257.1| PREDICTED: two-component response regulator ... 60 4e-07 ref|XP_002315852.1| hypothetical protein POPTR_0010s11600g [Popu... 57 4e-06 emb|CBM42561.1| putative B-type response regulator 16 [Populus x... 56 5e-06 >gb|EYU30138.1| hypothetical protein MIMGU_mgv1a003601mg [Mimulus guttatus] gi|604318647|gb|EYU30139.1| hypothetical protein MIMGU_mgv1a003601mg [Mimulus guttatus] Length = 575 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 MS+ SQVR +V+N+G+KVKQEPN+ +NV++GIPVQQH NDLMSVFSD Sbjct: 525 MSSTSQVRLYVQNNGSKVKQEPNLGFAENVRMGIPVQQHLPPNDLMSVFSD 575 >ref|XP_007225140.1| hypothetical protein PRUPE_ppa002493mg [Prunus persica] gi|462422076|gb|EMJ26339.1| hypothetical protein PRUPE_ppa002493mg [Prunus persica] Length = 667 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/52 (50%), Positives = 43/52 (82%) Frame = -1 Query: 396 RMSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 ++SN ++ + +VEN+GN VK+EP+M+++DN K+GIP+ Q FS +D MSVF++ Sbjct: 616 QVSNLNRGKIYVENNGNPVKEEPSMNLVDNAKVGIPILQEFSCSDFMSVFTE 667 >ref|XP_006448147.1| hypothetical protein CICLE_v10014527mg [Citrus clementina] gi|567911669|ref|XP_006448148.1| hypothetical protein CICLE_v10014527mg [Citrus clementina] gi|557550758|gb|ESR61387.1| hypothetical protein CICLE_v10014527mg [Citrus clementina] gi|557550759|gb|ESR61388.1| hypothetical protein CICLE_v10014527mg [Citrus clementina] Length = 663 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/51 (49%), Positives = 40/51 (78%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 M+N + +++N+ NKVK+EPN++ +DN K+GIP+ Q ++ NDLMSVF+D Sbjct: 613 MNNLNYGNIYLDNNANKVKEEPNLEFVDNAKVGIPMYQQYAPNDLMSVFTD 663 >ref|XP_007045291.1| Two-component response regulator ARR14 isoform 1 [Theobroma cacao] gi|590696902|ref|XP_007045292.1| Two-component response regulator ARR14 isoform 1 [Theobroma cacao] gi|590696905|ref|XP_007045293.1| Two-component response regulator ARR14 isoform 1 [Theobroma cacao] gi|508709226|gb|EOY01123.1| Two-component response regulator ARR14 isoform 1 [Theobroma cacao] gi|508709227|gb|EOY01124.1| Two-component response regulator ARR14 isoform 1 [Theobroma cacao] gi|508709228|gb|EOY01125.1| Two-component response regulator ARR14 isoform 1 [Theobroma cacao] Length = 676 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/50 (54%), Positives = 39/50 (78%) Frame = -1 Query: 390 SNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 S+ S+ + EN+G +VKQEP+M+ +DNVK+GIP+ Q F NDLMSVF++ Sbjct: 627 SSSSRGKVFAENTGTRVKQEPSMEFVDNVKVGIPMLQQFPPNDLMSVFTE 676 >ref|XP_007045295.1| Uncharacterized protein TCM_011069 [Theobroma cacao] gi|508709230|gb|EOY01127.1| Uncharacterized protein TCM_011069 [Theobroma cacao] Length = 354 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -1 Query: 390 SNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 S+ S+ + ENSG +VKQEP M+ +DNVKLGIP+ Q F NDL SVF++ Sbjct: 305 SSSSRGKVFAENSGTRVKQEPRMEFVDNVKLGIPMLQQFPPNDLTSVFTE 354 >ref|XP_002533196.1| two-component sensor histidine kinase bacteria, putative [Ricinus communis] gi|223526994|gb|EEF29188.1| two-component sensor histidine kinase bacteria, putative [Ricinus communis] Length = 669 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -1 Query: 390 SNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 SN S + +VEN+ NKVKQEPN+D D ++GIPV Q + NDLMSVF++ Sbjct: 620 SNLSHGKLYVENNDNKVKQEPNIDFTDTSRVGIPVLQQYPPNDLMSVFTE 669 >gb|EXB32324.1| Two-component response regulator [Morus notabilis] Length = 679 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFS 244 MSN + + H E++GN VKQEP+MD DN KLG PV + F NDLMSVF+ Sbjct: 629 MSNLNPGKVHSESNGNLVKQEPSMDFGDNAKLGTPVFRQFPSNDLMSVFT 678 >ref|XP_006469262.1| PREDICTED: two-component response regulator ARR2-like isoform X6 [Citrus sinensis] Length = 637 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/51 (47%), Positives = 40/51 (78%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 M+N + +++N+ NKVK+EPN++ ++N K+GIP+ Q ++ NDLMSVF+D Sbjct: 587 MNNLNYGNIYLDNNANKVKEEPNLEFVENAKVGIPMYQQYAPNDLMSVFTD 637 >ref|XP_006469261.1| PREDICTED: two-component response regulator ARR2-like isoform X5 [Citrus sinensis] Length = 641 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/51 (47%), Positives = 40/51 (78%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 M+N + +++N+ NKVK+EPN++ ++N K+GIP+ Q ++ NDLMSVF+D Sbjct: 591 MNNLNYGNIYLDNNANKVKEEPNLEFVENAKVGIPMYQQYAPNDLMSVFTD 641 >ref|XP_006469260.1| PREDICTED: two-component response regulator ARR2-like isoform X4 [Citrus sinensis] Length = 663 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/51 (47%), Positives = 40/51 (78%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 M+N + +++N+ NKVK+EPN++ ++N K+GIP+ Q ++ NDLMSVF+D Sbjct: 613 MNNLNYGNIYLDNNANKVKEEPNLEFVENAKVGIPMYQQYAPNDLMSVFTD 663 >ref|XP_006469257.1| PREDICTED: two-component response regulator ARR2-like isoform X1 [Citrus sinensis] gi|568829911|ref|XP_006469258.1| PREDICTED: two-component response regulator ARR2-like isoform X2 [Citrus sinensis] gi|568829913|ref|XP_006469259.1| PREDICTED: two-component response regulator ARR2-like isoform X3 [Citrus sinensis] Length = 668 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/51 (47%), Positives = 40/51 (78%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHFSQNDLMSVFSD 241 M+N + +++N+ NKVK+EPN++ ++N K+GIP+ Q ++ NDLMSVF+D Sbjct: 618 MNNLNYGNIYLDNNANKVKEEPNLEFVENAKVGIPMYQQYAPNDLMSVFTD 668 >ref|XP_002315852.1| hypothetical protein POPTR_0010s11600g [Populus trichocarpa] gi|222864892|gb|EEF02023.1| hypothetical protein POPTR_0010s11600g [Populus trichocarpa] Length = 663 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/53 (50%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHF--SQNDLMSVFSD 241 MS+ +S++E SGNKVKQEPN++ MDN ++GIP+ Q + +DLMSVF++ Sbjct: 611 MSSLDHEKSYMEISGNKVKQEPNIEYMDNARVGIPILQQLPPAPSDLMSVFTE 663 >emb|CBM42561.1| putative B-type response regulator 16 [Populus x canadensis] Length = 663 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/53 (50%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -1 Query: 393 MSNQSQVRSHVENSGNKVKQEPNMDMMDNVKLGIPVQQHF--SQNDLMSVFSD 241 MS+ +S++E SGNKVKQEPN++ MDN ++GIP+ Q + +DLMSVF++ Sbjct: 611 MSSLDHEKSYMEISGNKVKQEPNIEFMDNARVGIPMLQQLPPAPSDLMSVFTE 663