BLASTX nr result
ID: Mentha26_contig00026952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026952 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74093.1| hypothetical protein M569_00665, partial [Genlise... 60 2e-07 >gb|EPS74093.1| hypothetical protein M569_00665, partial [Genlisea aurea] Length = 54 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = +2 Query: 47 KQLTLAVCGLLTGVTCIAVGAHLSYSNNAPXXXXXXXXKEYVKARLRKLLQD 202 KQL ++ CG++TG+ C AVGAH S++N AP +E++KARLRK++ D Sbjct: 3 KQLAISFCGVITGIVCTAVGAHFSFANVAPQQARHQARREFLKARLRKIIDD 54