BLASTX nr result
ID: Mentha26_contig00026766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026766 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209059.1| hypothetical protein PRUPE_ppa016934mg [Prun... 61 1e-07 ref|XP_004159959.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding ... 59 5e-07 ref|XP_004143919.1| PREDICTED: RNA-binding protein NOB1-like [Cu... 59 5e-07 gb|EYU29742.1| hypothetical protein MIMGU_mgv1a007755mg [Mimulus... 59 7e-07 ref|XP_006352279.1| PREDICTED: RNA-binding protein NOB1-like [So... 58 2e-06 ref|XP_006344899.1| PREDICTED: RNA-binding protein NOB1-like [So... 58 2e-06 ref|XP_007040192.1| RNA-binding protein nob1, putative isoform 2... 58 2e-06 ref|XP_007040191.1| RNA-binding protein nob1, putative isoform 1... 58 2e-06 ref|XP_004244609.1| PREDICTED: uncharacterized protein LOC101252... 58 2e-06 ref|XP_006476589.1| PREDICTED: RNA-binding protein NOB1-like [Ci... 57 3e-06 ref|XP_006439575.1| hypothetical protein CICLE_v10019281mg [Citr... 57 3e-06 >ref|XP_007209059.1| hypothetical protein PRUPE_ppa016934mg [Prunus persica] gi|462404794|gb|EMJ10258.1| hypothetical protein PRUPE_ppa016934mg [Prunus persica] Length = 656 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPR 246 +TDKKAPLQPP+RKALAVFSG+RNPND Y+P+ Sbjct: 622 HTDKKAPLQPPIRKALAVFSGRRNPNDNHYSPK 654 >ref|XP_004159959.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein NOB1-like [Cucumis sativus] Length = 617 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 NTDK+APLQPPVR+ALAVFSGKRNPND Y+ K Sbjct: 582 NTDKRAPLQPPVRQALAVFSGKRNPNDNHYSRSK 615 >ref|XP_004143919.1| PREDICTED: RNA-binding protein NOB1-like [Cucumis sativus] Length = 617 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 NTDK+APLQPPVR+ALAVFSGKRNPND Y+ K Sbjct: 582 NTDKRAPLQPPVRQALAVFSGKRNPNDNHYSRSK 615 >gb|EYU29742.1| hypothetical protein MIMGU_mgv1a007755mg [Mimulus guttatus] Length = 396 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +T+K+ P+QPPVRKALAVFSGKRNPND YAP K Sbjct: 362 HTNKRGPIQPPVRKALAVFSGKRNPNDNHYAPPK 395 >ref|XP_006352279.1| PREDICTED: RNA-binding protein NOB1-like [Solanum tuberosum] Length = 647 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +T KKAPLQPPVRKALAVFSGKRNPND Y+ K Sbjct: 613 HTSKKAPLQPPVRKALAVFSGKRNPNDNHYSRAK 646 >ref|XP_006344899.1| PREDICTED: RNA-binding protein NOB1-like [Solanum tuberosum] Length = 645 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +T KKAPLQPPVRKALAVFSGKRNPND Y+ K Sbjct: 611 HTSKKAPLQPPVRKALAVFSGKRNPNDNHYSHAK 644 >ref|XP_007040192.1| RNA-binding protein nob1, putative isoform 2 [Theobroma cacao] gi|508777437|gb|EOY24693.1| RNA-binding protein nob1, putative isoform 2 [Theobroma cacao] Length = 612 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +TDK+APLQPPVRKALAVF+GKRNPND Y+ K Sbjct: 576 HTDKRAPLQPPVRKALAVFTGKRNPNDNHYSRSK 609 >ref|XP_007040191.1| RNA-binding protein nob1, putative isoform 1 [Theobroma cacao] gi|508777436|gb|EOY24692.1| RNA-binding protein nob1, putative isoform 1 [Theobroma cacao] Length = 611 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +TDK+APLQPPVRKALAVF+GKRNPND Y+ K Sbjct: 576 HTDKRAPLQPPVRKALAVFTGKRNPNDNHYSRSK 609 >ref|XP_004244609.1| PREDICTED: uncharacterized protein LOC101252008 [Solanum lycopersicum] Length = 647 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +T KKAPLQPPVRKALAVFSGKRNPND Y+ K Sbjct: 613 HTSKKAPLQPPVRKALAVFSGKRNPNDNHYSRAK 646 >ref|XP_006476589.1| PREDICTED: RNA-binding protein NOB1-like [Citrus sinensis] Length = 632 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +TDK+APLQPP+RKALAVFSG+RNPND Y+ K Sbjct: 598 HTDKRAPLQPPIRKALAVFSGRRNPNDNHYSHPK 631 >ref|XP_006439575.1| hypothetical protein CICLE_v10019281mg [Citrus clementina] gi|557541837|gb|ESR52815.1| hypothetical protein CICLE_v10019281mg [Citrus clementina] Length = 632 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 344 NTDKKAPLQPPVRKALAVFSGKRNPNDIRYAPRK 243 +TDK+APLQPP+RKALAVFSG+RNPND Y+ K Sbjct: 598 HTDKRAPLQPPIRKALAVFSGRRNPNDNHYSHPK 631